SecReT6
Protein ID: 512648117
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00850
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]39796..40839 [+]
Producthypothetical protein
NoteTssG
UniProt IDR9VJT3
KEGG IDenr:H650_00850
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.70E-107, Aligned region: 27..331
Protein Sequence: 347 a.a.     [Download]
>gi|512648117|ref|YP_008106026.1| hypothetical protein H650_00850 [Enterobacter sp. R4-368]
MTETLSSAPVITRASALPEAFWQNVMATPWRYDLFTLLRRVDARGGERYPLGRAPLPRFEPLRIGQTPSL
GFAPSTLSSVRQRENSSLYDVSILSFGLFGPNGPLPVHLTEYASERIAHHQDDSLSAFADLFHHRLALLF
YRAWADAQPTVSLDRQDNKRFEQYIASLIGMGQPGQLEKGSLSPHARFALAGHLTRNGRDPEGLAKILRI
YFNVPVTIVENVPQWMPLSERERARLQGGRHAPRLGQSAFLGEAVRDVCHKFRIEIGPLNVDTYRRFMPG
EQWVTALRDWVRQYLGIEYQWAVKVILRSEDVAGATLGGAGRLGYSAWLGTQPRPQARGDLVFSPEG
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|512647881|ref|NC_021500.1|:39796-40839 Enterobacter sp. R4-368, complete genome
ATGACCGAAACGCTGAGCAGCGCGCCGGTCATTACGCGCGCCAGTGCGCTGCCGGAGGCATTCTGGCAAA
ACGTAATGGCGACGCCGTGGCGCTACGATCTGTTTACGCTGCTGCGCCGCGTCGATGCGCGTGGCGGTGA
GCGTTACCCGCTGGGTCGCGCGCCGCTGCCGCGTTTTGAGCCGTTGCGCATTGGTCAAACCCCCTCACTT
GGCTTTGCGCCATCGACGCTGTCAAGCGTGCGCCAACGCGAAAACTCGTCGCTGTATGACGTCTCGATTC
TCAGTTTTGGCCTGTTTGGCCCCAACGGCCCGCTGCCGGTTCACCTGACTGAATACGCCAGCGAACGTAT
CGCGCACCACCAGGATGACAGCCTGAGCGCCTTCGCCGATCTTTTTCATCACCGCCTGGCGCTGCTGTTT
TACCGCGCCTGGGCCGATGCGCAACCGACTGTTTCGCTGGATCGCCAGGATAACAAACGTTTTGAGCAGT
ACATCGCCTCGCTGATCGGCATGGGGCAGCCAGGACAACTGGAAAAAGGCAGCTTAAGCCCGCACGCCCG
CTTTGCCCTTGCCGGGCATCTGACCCGCAACGGGCGCGACCCGGAAGGGCTGGCGAAGATCCTGCGCATC
TATTTCAACGTGCCGGTCACCATTGTCGAAAACGTGCCGCAGTGGATGCCGCTCAGTGAACGTGAACGCG
CGCGCTTACAGGGCGGGCGACACGCGCCGCGCCTCGGGCAATCGGCGTTTCTTGGCGAAGCTGTACGCGA
TGTGTGCCATAAGTTTCGCATCGAAATTGGCCCGCTTAACGTCGATACCTACCGGCGCTTTATGCCGGGT
GAACAGTGGGTTACCGCGCTACGCGACTGGGTGCGCCAGTATCTGGGCATTGAGTACCAGTGGGCGGTGA
AAGTGATTTTGCGCAGTGAAGATGTCGCTGGTGCCACGCTTGGTGGAGCCGGGCGTCTGGGTTACAGCGC
CTGGCTTGGTACACAGCCCAGGCCACAGGCGCGAGGAGATTTGGTTTTCAGCCCGGAGGGGTAA