SecReT6
Protein ID: 512648118
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00855
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]40941..43571 [+]
ProductATPase AAA
NoteTssH
UniProt IDR9VFM2
KEGG IDenr:H650_00855
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.10E-40, Aligned region: 228..246
AAA_2 [PF07724], Evalue: 4.10E-40, Aligned region: 607..772
AAA [PF00004], Evalue: 1.00E-20, Aligned region: 150..165
AAA [PF00004], Evalue: 1.00E-20, Aligned region: 228..361
AAA [PF00004], Evalue: 1.00E-20, Aligned region: 613..697
ClpB_D2-small [PF10431], Evalue: 1.00E-15, Aligned region: 780..855
AAA_5 [PF07728], Evalue: 9.80E-13, Aligned region: 228..254
AAA_5 [PF07728], Evalue: 9.80E-13, Aligned region: 612..731
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 3..82
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 205..248
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 273..306
AAA_16 [PF13191], Evalue: 1.10E-09, Aligned region: 609..657
AAA_22 [PF13401], Evalue: 3.80E-08, Aligned region: 228..308
AAA_22 [PF13401], Evalue: 3.80E-08, Aligned region: 371..394
AAA_22 [PF13401], Evalue: 3.80E-08, Aligned region: 611..643
AAA_22 [PF13401], Evalue: 3.80E-08, Aligned region: 673..695
Sigma54_activat [PF00158], Evalue: 2.20E-07, Aligned region: 210..246
Sigma54_activat [PF00158], Evalue: 2.20E-07, Aligned region: 612..728
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 228..309
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 334..394
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 611..722
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 227..252
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 610..634
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 227..252
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 281..325
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 506..532
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 606..637
IstB_IS21 [PF01695], Evalue: 2.20E-05, Aligned region: 214..247
IstB_IS21 [PF01695], Evalue: 2.20E-05, Aligned region: 612..640
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 228..269
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 612..648
Zeta_toxin [PF06414], Evalue: 5.60E-05, Aligned region: 227..248
Zeta_toxin [PF06414], Evalue: 5.60E-05, Aligned region: 605..662
NACHT [PF05729], Evalue: 5.90E-05, Aligned region: 228..263
NACHT [PF05729], Evalue: 5.90E-05, Aligned region: 613..644
TSKS [PF15358], Evalue: 5.90E-05, Aligned region: 424..558
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 206..242
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 281..311
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 357..402
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 611..651
Clp_N [PF02861], Evalue: 0.00012, Aligned region: 32..79
Clp_N [PF02861], Evalue: 0.00012, Aligned region: 120..135
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 228..248
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 614..641
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 806..861
AAA_29 [PF13555], Evalue: 0.0007, Aligned region: 220..244
AAA_29 [PF13555], Evalue: 0.0007, Aligned region: 610..637
FtsK_SpoIIIE [PF01580], Evalue: 0.0027, Aligned region: 212..271
FtsK_SpoIIIE [PF01580], Evalue: 0.0027, Aligned region: 455..509
FtsK_SpoIIIE [PF01580], Evalue: 0.0027, Aligned region: 612..634
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 229..249
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 613..634
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 710..731
SRP54 [PF00448], Evalue: 0.0049, Aligned region: 227..248
SRP54 [PF00448], Evalue: 0.0049, Aligned region: 611..648
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 226..245
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 298..308
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 579..633
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 681..705
Hpr_kinase_C [PF07475], Evalue: 0.0091, Aligned region: 228..240
Hpr_kinase_C [PF07475], Evalue: 0.0091, Aligned region: 610..630
Protein Sequence: 876 a.a.     [Download]
>gi|512648118|ref|YP_008106027.1| ATPase AAA [Enterobacter sp. R4-368]
MDELMSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQTDGDLQQVIRHFSLDEEA
LTRDIVAALDKLPRGASSVSDLSEHIDTAVERAWVYGSLKYGVTRIRGGHLLAGILKTWSLANVLKGISP
QFERISADALLDNFDAIFANSKESQQVTVALNDDAGAGVPQQQGTLAQYGQDLTARARDGKIDPVVGRDE
EIRQMVDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGDVPEPLVDVQLWLLDIGMLQAGAGMKGEF
EARLQSLINEVQSSPTPIILFIDEIHTLIGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEK
DPALTRRFQTVQVAEPDEEKAVLMLRSTVSALEKHHRVLLLDEAVVAAVKLSHRYIPARQLPDKAVALLD
TACARVAVSQSSPPPQLEDCLHRIAALDVEVEIANREAKMATGESDRVEKLQVELEKLAQQRDELTARWE
QEQALVDAIIALRAQLHTSPEEAQADLRATLTQQQAELRALQGDAPLLFTSVDANVVAAVVSDWTGIPLG
RMVKNEIDAVLKLADTLNERVIGQRHGLELIAKRVQTSRARLDDPNKPVGVFMLCGPSGVGKTETALALA
ESLYGGEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEI
FFQVFDKGWMEDGEGRHIDFRNTIIILTSNVGTELITGMCADPELMPEPDALRDALRPPLLQVFPPALLG
RLLVVPYYPLSDEMLAMIVRLQLKRIQRRLADNHGIVSEVDDSVVEQIVARCTEVESGGRMVDAILTNTL
LPLMSQLLLDASARDEQYKRLRVTFEQGEFHCQFAA
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|512647881|ref|NC_021500.1|:40941-43571 Enterobacter sp. R4-368, complete genome
ATGGATGAACTCATGTCAGAAATCAGCCGCGCCGTTCTGTTCGGCAAACTCGATACGCTGTTATTTACCT
CGCTGGAAAGCGCCACCGCCTTTTGCAAGCTGCGTGGCAACCCGTATGTGGAGCTGGTTCACTGGCTGCA
TCAACTGATGCAACAGACGGACGGCGATCTGCAACAGGTTATTCGCCACTTTTCGCTGGATGAAGAGGCG
CTGACGCGCGATATCGTCGCGGCGCTGGACAAACTGCCGCGCGGCGCAAGTTCGGTTTCCGACTTGTCAG
AACACATTGATACCGCCGTTGAACGCGCGTGGGTATATGGCTCGTTAAAATATGGCGTGACGCGCATTCG
TGGCGGCCATCTGCTGGCCGGGATCCTGAAAACCTGGAGTCTGGCGAACGTGCTGAAAGGCATTTCGCCG
CAGTTTGAGCGTATCAGCGCCGATGCGTTGCTGGATAACTTCGACGCCATTTTCGCTAACAGCAAAGAGA
GCCAGCAGGTCACCGTGGCGCTGAACGATGACGCAGGCGCAGGCGTACCGCAGCAACAGGGCACGCTGGC
GCAGTATGGTCAGGATCTGACCGCCCGGGCGCGCGACGGCAAAATCGACCCGGTAGTGGGGCGCGATGAA
GAGATCCGCCAGATGGTCGATATCCTGATGCGTCGCCGCCAGAACAACCCGTTGCTGACCGGTGAAGCGG
GCGTCGGTAAAACGGCGGTCGTGGAAGGGCTGGCGCTGCGCATTGCCGCAGGTGATGTGCCGGAGCCGCT
GGTGGATGTGCAACTGTGGCTGCTTGATATTGGCATGTTGCAGGCGGGCGCGGGAATGAAGGGCGAATTT
GAAGCGCGTTTACAGTCGTTGATTAACGAAGTGCAATCCAGCCCGACGCCGATCATTCTGTTTATCGACG
AAATTCACACGCTGATTGGCGCCGGCGGCCAGCAGGGCACGGGCGATGCCGCCAACCTGCTGAAACCGGC
GCTGGCGCGTGGTCAGCTTCGCACCATCGGCGCGACCACCTGGGCGGAATACAAAAAATACATTGAGAAA
GATCCGGCGCTGACCCGCCGTTTCCAGACCGTACAAGTCGCCGAACCAGACGAAGAAAAAGCCGTTCTGA
TGCTGCGCAGCACCGTTTCCGCCCTGGAAAAACACCACCGCGTGCTGCTGCTGGATGAAGCGGTTGTCGC
GGCGGTGAAACTCTCGCACCGCTACATTCCGGCGCGCCAGTTGCCGGATAAAGCCGTTGCGCTGCTCGAT
ACCGCCTGTGCGCGCGTCGCGGTAAGCCAAAGTTCTCCGCCGCCGCAGCTGGAAGATTGCCTGCACCGCA
TCGCCGCGCTGGACGTGGAAGTTGAAATTGCCAACCGTGAAGCGAAAATGGCGACCGGTGAAAGCGATCG
CGTGGAAAAATTGCAGGTCGAGCTGGAAAAACTGGCGCAACAACGCGACGAACTGACGGCGCGCTGGGAG
CAGGAGCAAGCGCTGGTTGACGCGATTATTGCGCTGCGCGCGCAGCTGCATACTTCGCCGGAAGAGGCGC
AGGCCGATTTACGCGCCACGCTGACGCAACAGCAGGCCGAACTGCGTGCGCTACAGGGCGACGCGCCACT
GCTGTTTACCTCGGTGGATGCCAACGTGGTCGCCGCCGTGGTTTCCGACTGGACCGGCATCCCGCTGGGC
CGGATGGTGAAAAACGAAATCGATGCGGTGTTAAAACTGGCCGATACCCTGAACGAACGCGTAATTGGAC
AGCGCCACGGCCTGGAACTGATTGCCAAACGGGTACAGACCTCGCGTGCGCGCCTGGACGATCCGAACAA
ACCGGTAGGCGTCTTTATGCTGTGCGGCCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCGCTGGCG
GAGTCGCTGTACGGCGGCGAGCAGAACGTTATCACCATCAACATGAGTGAGTTCCAGGAAGCACATACGG
TTTCCACGCTGAAAGGTGCGCCTCCGGGATATGTGGGTTACGGCGAAGGCGGTGTGTTAACCGAAGCGGT
GCGCCGCCGTCCTTACAGCGTGGTGCTGCTCGATGAGATCGAAAAAGCCCACCCGGATGTGCATGAAATC
TTCTTCCAGGTGTTCGATAAAGGCTGGATGGAAGATGGCGAAGGCCGCCATATTGATTTCCGTAACACCA
TTATTATTCTCACCTCCAACGTCGGGACTGAGCTGATTACCGGCATGTGCGCCGATCCGGAACTGATGCC
GGAACCGGACGCCCTGCGCGACGCGCTGCGCCCGCCGCTGTTGCAGGTTTTCCCGCCCGCGCTGCTGGGC
CGTTTGCTGGTGGTGCCGTACTACCCGCTCAGCGACGAGATGCTGGCGATGATTGTGCGCCTGCAGCTTA
AACGCATTCAGCGCCGTCTGGCGGACAACCACGGGATTGTGTCGGAAGTGGACGACAGCGTGGTGGAACA
AATTGTTGCCCGCTGCACGGAAGTCGAATCAGGCGGCCGTATGGTGGACGCCATCCTTACTAATACACTG
CTGCCGCTGATGAGCCAGCTATTACTCGACGCCAGCGCGCGCGACGAGCAATATAAGCGCTTACGGGTCA
CGTTTGAGCAGGGTGAGTTTCACTGTCAGTTTGCGGCGTAA