SecReT6
Protein ID: 512648121
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00870
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]45645..47873 [+]
Producthypothetical protein
NoteTssI
UniProt IDR9VFZ9
KEGG IDenr:H650_00870
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-70, Aligned region: 22..326
Phage_GPD [PF05954], Evalue: 2.30E-70, Aligned region: 524..564
Phage_base_V [PF04717], Evalue: 4.30E-25, Aligned region: 364..457
Protein Sequence: 742 a.a.     [Download]
>gi|512648121|ref|YP_008106030.1| hypothetical protein H650_00870 [Enterobacter sp. R4-368]
MQNRITATLPVGGLLFWKLSGREALSESFTLALTVLGTDARADRSKLLGQSATINIPTQGTGMRYINGKI
TRVAVSAVELSGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTAPQIVKTLLGEYQVNVEDKLTGSYRTWD
YCVQYQESSLDFISRLMELEGIAYHFRHEADRHVLVLTDAATEHQPFSGYETIPYHQTPSGGSTDEEGIS
QWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPASPQPGSIDVYDWPGRFVEHGHGEYYARIRQERWQV
EHQQIQGTATAVGVAPGNTFALYNAPFFSDNGEYLTTEANYFFEENRYASGSDGETVHRIDFTVIPSSVV
FRPAAVTAWPKTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGGV
QIPRVGDEVVIDFINGDPDRPIVTGRVYNESSMPPWTLPDDSTRMGFMTRSKDGSKDNASYLFFEDRAGS
EAVELHSEKDMKVSVENDKTVNIDGNRTTTILKEQKDDVTGDASFYYRAKRTTTVDEAETTTFNNSQTET
IKNGRTLNITSGGDVVNIKGDRITDIDGTNLHHVTKLVTEKFDGGLNTTIANGVALNITSNGSQQNIKGN
VLVNVEGDYTKLVSSKIVIKAPSIVFDSPSVEYTHKEEKSFWEDYFSAKTVSFAFKGGDASVSLLSTAFK
GMAYNKTGFEISKEEGMVAFKNTLYHTQANLRSMAFALMLVL
 
Nucleotide Sequence: 2229 bp     [Download]
>gi|512647881|ref|NC_021500.1|:45645-47873 Enterobacter sp. R4-368, complete genome
ATGCAGAACAGAATCACGGCGACGTTACCCGTCGGGGGCTTACTTTTCTGGAAACTCTCCGGGCGCGAAG
CGCTGTCCGAGTCATTTACGCTGGCGCTGACGGTACTGGGCACCGATGCGCGGGCAGACCGCAGCAAGCT
GCTGGGGCAATCCGCAACCATCAATATTCCCACCCAGGGAACGGGCATGCGCTATATCAACGGCAAAATC
ACCCGCGTGGCGGTGAGCGCCGTTGAACTTTCGGGGACGCGTTACGCGGTGTACCAGCTCACCGTGGAGC
CGGATTTGTGGCCGATGAAACGCGACCGCAACCTGCGTATCTTCCAGGGCCAGACTGCGCCGCAGATTGT
GAAAACGCTGCTCGGCGAATATCAGGTGAACGTGGAAGATAAGCTGACCGGCAGTTACCGCACCTGGGAT
TACTGCGTGCAGTACCAGGAATCGAGCCTCGATTTCATCAGCCGTCTGATGGAGCTTGAGGGCATCGCCT
ACCATTTCCGCCACGAAGCCGACCGCCATGTGCTGGTGCTGACCGACGCGGCGACCGAACATCAGCCCTT
CAGCGGCTACGAAACCATTCCGTATCACCAGACGCCGTCCGGCGGCAGCACGGATGAAGAGGGTATCAGC
CAGTGGGCGCTGGAGGACAGCGTGACGCCGGGCATTTACAGCCTCGACGATTACGACTTCCGCAAACCGA
ACGCGTGGCTGTTCCAGGCGCGGCAGAACCCGGCGTCACCGCAGCCGGGCAGCATTGACGTGTACGACTG
GCCGGGGCGTTTTGTCGAGCACGGTCACGGGGAGTATTACGCACGTATCCGCCAGGAGCGCTGGCAGGTG
GAGCACCAGCAGATTCAGGGCACCGCCACGGCGGTTGGTGTCGCACCGGGAAACACCTTCGCGCTGTATA
ACGCGCCGTTTTTCAGCGATAACGGCGAGTACCTGACCACCGAAGCGAACTACTTTTTCGAGGAAAACCG
CTACGCCAGCGGCTCTGATGGCGAAACGGTGCACCGCATTGATTTCACCGTCATTCCGTCGTCGGTGGTG
TTCCGCCCGGCGGCGGTGACGGCGTGGCCGAAAACCTACGGGCCGCAGACGGCAAAAGTGGTCGGCCCGC
AGGGCGAGAGCATCTGGACGGATAAATATGGCCGGGTGAAGGTGAAATTCCACTGGGACCGTCTGGCGAA
AGGCGATGACACCAGCTCCTGCTGGGTGCGTGTGTCGAGTGCCTGGGCGGGGCAGGGCTTCGGCGGGGTG
CAGATCCCGCGCGTGGGCGACGAAGTGGTGATCGACTTTATTAACGGTGATCCGGACCGGCCGATCGTTA
CCGGGCGTGTCTATAACGAATCCAGCATGCCGCCGTGGACACTGCCGGATGATTCAACTCGCATGGGCTT
TATGACCCGCAGTAAAGACGGCAGCAAAGACAACGCCAGCTACCTGTTTTTTGAGGATCGCGCCGGGAGT
GAAGCTGTTGAGTTGCATTCCGAAAAAGATATGAAAGTCTCGGTGGAAAATGACAAGACGGTCAACATTG
ACGGTAATCGCACGACGACCATTCTGAAAGAGCAGAAAGACGATGTCACCGGCGACGCCTCGTTTTACTA
TCGGGCGAAGCGCACGACTACGGTAGATGAAGCGGAAACCACCACCTTCAACAACAGCCAGACGGAAACC
ATCAAGAATGGGCGTACGCTGAATATCACCAGCGGCGGTGATGTTGTTAATATTAAAGGTGATCGTATAA
CCGATATTGACGGCACGAATTTGCATCATGTTACTAAATTAGTTACTGAGAAATTTGATGGTGGCCTTAA
CACTACTATTGCCAATGGGGTAGCGCTTAATATTACAAGTAACGGGAGCCAGCAAAATATTAAGGGTAAT
GTGCTGGTTAATGTTGAAGGTGATTACACAAAATTGGTATCCAGCAAGATAGTTATAAAAGCACCAAGCA
TCGTGTTTGACTCTCCTTCTGTAGAATATACTCATAAAGAAGAAAAGAGTTTTTGGGAGGATTATTTTAG
TGCGAAAACAGTGTCATTTGCATTTAAAGGTGGTGATGCTAGTGTGTCGTTGCTTTCCACGGCTTTCAAA
GGAATGGCTTATAATAAAACAGGATTTGAGATTTCTAAAGAGGAAGGCATGGTGGCGTTTAAAAATACTC
TATACCATACGCAAGCAAATTTGCGGAGTATGGCTTTTGCTCTCATGCTAGTATTATGA