SecReT6
Protein ID: 512648134
SecReT6 ID809
T6SS typei3
Gene symbol-
Locus tagH650_00935
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]56608..59217 [+]
Producthypothetical protein
NoteTssI
UniProt IDR9VK51
KEGG IDenr:H650_00935
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.20E-71, Aligned region: 22..326
Phage_base_V [PF04717], Evalue: 3.10E-25, Aligned region: 364..457
Protein Sequence: 869 a.a.     [Download]
>gi|512648134|ref|YP_008106043.1| hypothetical protein H650_00935 [Enterobacter sp. R4-368]
MANRITATLPVGGLLFWKLSGREALSESFTLALTVLGTDARADRSKLLGQSATINIPTQGTGTRYINGKI
TRVAVSAVELSGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTAPQIVKTLLGEYQVNVEDKLTGSYRTWD
YCVQYQESSLDFISRLMELEGIAYHFRHEADRHVLVLTDAATEHQPFSGYETIPYHQTPSGGSTDEEGIS
QWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPASPQPGSIDVYDWPGRFVEHGHGEYYARIRQERWQV
EHQQIQGTATAVGVAPGNTFALYNAPFFSDNGEYLTTEANYFFEENRYASGSDGETVHRIDFTVIPSSVV
FRPAAVTAWPKTYGPQTAKVVGPQGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGGV
QIPRVGDEVVIDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFLSRSKDGSVDNANALRFEDKAGE
EQVWIQAERNMDVHVKNDASRSIGSNHSHYVRKNELYRVETNQTQAVKGQTEILTGKGKLDAVVEQFILA
SGTQLRLVSGHSAIELNANGKINLIGKSFNFFVEEDGHITTGGKLHLNAPGTKAPTTAPGADHKGNINSA
VQAKFSPQGNVQHAAPVAAAPAGAAKPVTKYKAPPPLKGDYVFSNEKSKSQFMPFSDGVVKKINSSPKMQ
SDLKKLMDDQWNISPNVPGGGSWTDTKNKVMVLDPESMADDNEAVMTLAHEVGHATSPYKNDFSSKSNFV
NGMLKDEGQATLNEIQVRREIYHNSGIDIGSMTDSSNEMKYIQAFKDMDSGKITRDEASKAIGEIYRRGE
VASGSTTNEVYEDHYGNMYDDYMQGKAPH
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|512647881|ref|NC_021500.1|:56608-59217 Enterobacter sp. R4-368, complete genome
ATGGCGAACAGAATCACGGCGACGTTACCCGTCGGGGGCTTACTTTTCTGGAAACTCTCCGGGCGCGAAG
CGCTGTCGGAATCATTTACGCTGGCGCTGACGGTACTGGGCACCGATGCGCGGGCAGACCGCAGCAAGCT
GCTGGGGCAATCTGCAACCATCAATATTCCCACCCAGGGAACGGGCACGCGCTATATCAACGGCAAAATC
ACCCGCGTGGCGGTGAGCGCCGTTGAACTTTCGGGGACGCGTTACGCGGTGTATCAGCTCACCGTGGAGC
CGGATTTGTGGCCGATGAAACGCGACCGCAACCTGCGTATCTTCCAGGGCCAGACTGCGCCGCAGATAGT
GAAAACGCTGCTCGGCGAATATCAGGTGAACGTGGAAGATAAGCTGACCGGCAGTTACCGCACCTGGGAT
TACTGCGTGCAGTACCAGGAATCGAGCCTCGATTTCATCAGCCGTCTGATGGAGCTTGAGGGCATCGCCT
ACCATTTCCGCCACGAAGCCGACCGCCATGTGCTGGTGCTGACCGACGCGGCGACCGAACATCAGCCCTT
CAGCGGCTATGAAACCATTCCGTATCACCAGACGCCGTCCGGCGGCAGCACGGATGAAGAGGGTATCAGC
CAGTGGGCGCTTGAAGACAGCGTGACGCCGGGTATTTACAGCCTCGACGATTACGACTTCCGCAAACCGA
ACGCGTGGCTGTTCCAGGCGCGGCAGAACCCGGCATCACCGCAGCCGGGCAGCATTGACGTGTACGACTG
GCCGGGGCGTTTTGTCGAGCACGGTCACGGGGAGTATTACGCACGTATCCGCCAGGAGCGCTGGCAGGTG
GAGCACCAGCAGATTCAGGGCACCGCCACGGCGGTTGGTGTCGCACCGGGAAACACCTTTGCGCTGTATA
ACGCGCCGTTTTTCAGCGATAACGGCGAGTACCTGACCACCGAAGCGAACTACTTTTTCGAGGAAAACCG
CTATGCCAGCGGCTCCGACGGCGAAACGGTGCACCGCATCGATTTCACCGTCATTCCGTCGTCGGTGGTG
TTCCGCCCGGCGGCGGTGACGGCGTGGCCGAAAACCTACGGGCCGCAGACGGCGAAAGTGGTCGGCCCGC
AGGGCGAGAGCATCTGGACGGATAAATATGGCCGGGTGAAGGTGAAATTCCACTGGGACCGTCTGGCGAA
AGGCGATGACACCAGCTCCTGCTGGGTGCGTGTGTCGAGTGCCTGGGCGGGGCAGGGTTTCGGCGGGGTG
CAAATCCCGCGCGTGGGCGACGAAGTGGTGATCGACTTTATCAACGGTGATCCGGACCGGCCGATCGTTA
CCGGGCGTGTCTATAACGAAGCGAGTATGCCGCCGTGGGCATTACCTGCTGCTGCCACGCAGATGGGCTT
CCTCAGCCGCTCGAAAGATGGATCGGTCGATAACGCCAACGCCCTGCGCTTTGAAGACAAGGCGGGCGAA
GAGCAGGTGTGGATCCAGGCGGAACGTAACATGGATGTTCACGTCAAAAACGACGCCTCGCGCTCGATCG
GCAGTAACCACAGCCACTATGTACGTAAAAATGAGCTGTACCGCGTCGAAACAAATCAGACTCAGGCCGT
GAAAGGGCAAACGGAAATCCTTACCGGCAAAGGCAAGCTCGATGCGGTGGTGGAGCAGTTTATTCTGGCT
TCCGGGACGCAACTGCGGCTGGTATCCGGTCACAGCGCCATTGAGCTTAATGCGAATGGCAAAATCAACC
TGATTGGTAAATCCTTTAACTTCTTTGTCGAAGAAGATGGGCACATTACCACCGGCGGTAAGTTGCATCT
CAATGCTCCCGGAACAAAAGCCCCGACTACCGCGCCAGGAGCTGACCATAAAGGGAATATTAACTCTGCG
GTACAGGCGAAATTTTCCCCGCAGGGTAACGTGCAACACGCGGCCCCTGTGGCAGCGGCTCCGGCGGGGG
CGGCCAAACCGGTGACGAAATACAAAGCGCCACCGCCGCTGAAGGGGGATTATGTTTTTAGTAACGAGAA
GAGTAAAAGTCAATTCATGCCGTTCAGTGATGGCGTGGTGAAGAAAATAAACAGTTCCCCCAAAATGCAG
AGCGATTTAAAAAAGCTCATGGATGATCAGTGGAATATATCACCTAACGTTCCAGGGGGTGGAAGCTGGA
CCGATACGAAAAATAAAGTCATGGTATTAGATCCGGAAAGTATGGCGGATGATAATGAAGCGGTCATGAC
GCTGGCGCATGAAGTCGGCCATGCGACCAGCCCCTATAAAAATGACTTCAGCTCAAAAAGTAATTTTGTT
AACGGCATGCTTAAAGATGAAGGGCAGGCCACGCTGAATGAAATTCAGGTCCGCCGCGAAATTTATCATA
ATAGCGGTATAGATATTGGCTCAATGACTGACTCATCGAATGAGATGAAATATATCCAGGCATTTAAAGA
TATGGACAGCGGAAAAATAACCCGCGATGAAGCCAGTAAAGCAATTGGAGAAATTTACCGCAGGGGTGAA
GTTGCATCCGGTTCAACTACCAATGAAGTTTATGAAGACCATTACGGGAATATGTACGATGACTATATGC
AAGGTAAGGCACCTCACTAA