SecReT6
Protein ID: 512650043
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11140
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2176867..2178306 [-]
Producthypothetical protein
NoteTssA
UniProt IDR9VKT7
KEGG IDenr:H650_11140
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.80E-43, Aligned region: 110..153
DUF3702 [PF12486], Evalue: 2.80E-43, Aligned region: 314..457
ImpA-rel_N [PF06812], Evalue: 1.80E-21, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 1.80E-21, Aligned region: 362..384
Protein Sequence: 479 a.a.     [Download]
>gi|512650043|ref|YP_008108043.1| hypothetical protein H650_11140 [Enterobacter sp. R4-368]
MNDISPRKIKTGCDPRTLADYAILRDELSKLTHPARPDVNWRYVEKLCLSLFEQNGVELQTAAWYTLART
QLAGLFGLNEGLAILEALISHQWGVLWPQPVHARMEILCNLSQRLQQRMRTLPLNYSDLSQLYRAEQLLT
SLGAVLQRLELKHLSQLDTLRSMIHNSAVRLENSDGASDSGATIQAGIVLPAPVMNSAGILSDALPGIPV
TEKREPANTVNWVYVAHPEHQPNVDVLTAIPVQVKKWKPFAAGMWTMLIISAATVWGWHALHQVDPLQTQ
LAASLAPFPAILTPAQLDTLRQHASIPQTMFTATQQQLVRLGQLPPDWNIDYSRQLVEQAQSLWPEQAKP
LAQRWFRQLNAASVPTENLSGWHQGMTKLQQLSNRLSGLDGHKGKYMTVSELKSSVFGMMTSFQQTEPTE
EQLRQINLLPVGSPLRQQLIRQLEQHLRAQIYTLGQMKNSAPVTKLLREQAVNPSPLND
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2178306-2176867 Enterobacter sp. R4-368, complete genome
ATGAATGACATTTCCCCCCGTAAAATCAAAACCGGTTGCGACCCGCGTACTCTTGCGGATTATGCCATCC
TGCGCGATGAGTTGAGCAAACTGACCCATCCGGCGCGCCCGGACGTGAACTGGCGGTATGTAGAAAAACT
CTGTCTCTCATTGTTTGAGCAAAATGGCGTGGAATTGCAAACGGCCGCCTGGTATACGCTTGCCCGGACT
CAACTGGCCGGATTATTCGGTCTGAATGAAGGGCTGGCAATACTGGAGGCCCTGATAAGCCATCAGTGGG
GAGTGCTCTGGCCGCAGCCTGTACACGCCCGCATGGAAATCCTCTGTAATCTGAGTCAGCGCCTGCAGCA
ACGGATGCGTACGCTACCGCTGAACTACAGCGATCTCAGCCAGCTATACCGGGCGGAACAACTGCTAACG
AGTCTCGGCGCGGTGCTACAGCGCCTGGAGTTAAAACATCTGAGCCAGCTCGATACGTTGCGATCGATGA
TACATAACAGTGCTGTTCGGCTGGAAAATAGTGACGGCGCATCCGACTCTGGTGCAACTATTCAGGCTGG
TATCGTGCTGCCTGCGCCAGTAATGAATAGCGCCGGAATATTAAGCGATGCTCTGCCGGGTATTCCTGTT
ACCGAAAAGCGCGAACCGGCCAACACGGTAAATTGGGTTTATGTTGCCCATCCCGAACATCAGCCGAACG
TGGATGTACTGACGGCGATACCGGTACAGGTAAAAAAGTGGAAACCTTTTGCTGCCGGGATGTGGACCAT
GCTGATAATAAGTGCGGCGACGGTGTGGGGCTGGCATGCCTTGCATCAAGTTGACCCGTTACAGACTCAG
CTTGCTGCATCGCTGGCACCTTTTCCTGCAATACTCACGCCCGCGCAACTTGATACGCTGCGTCAGCACG
CTTCCATACCGCAAACCATGTTCACAGCTACGCAGCAGCAGCTCGTGCGCTTAGGTCAGTTGCCACCGGA
CTGGAATATTGACTACAGCCGTCAACTGGTCGAGCAGGCGCAGTCGCTCTGGCCTGAACAGGCGAAACCA
CTGGCACAACGGTGGTTTCGGCAGTTGAACGCAGCCAGCGTACCGACAGAAAATTTGAGTGGCTGGCATC
AGGGGATGACGAAGTTACAGCAACTGAGTAACCGGCTGAGTGGGCTGGATGGGCACAAGGGTAAATACAT
GACGGTCAGTGAGCTGAAGTCATCCGTCTTTGGCATGATGACTAGCTTTCAGCAGACTGAACCGACGGAG
GAACAGCTTCGTCAGATTAATTTATTGCCCGTCGGTTCTCCTCTGCGTCAGCAACTTATCCGGCAACTGG
AACAGCATCTCCGGGCACAGATTTATACACTGGGGCAGATGAAAAACAGCGCACCTGTAACGAAGTTGCT
GCGCGAACAAGCGGTAAATCCCAGCCCCCTGAACGATTAA