SecReT6
Protein ID: 512650044
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11145
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2178683..2179132 [-]
Producthypothetical protein
NoteTssE
UniProt IDR9VQL1
KEGG IDenr:H650_11145
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.5e-14, Aligned region: 26..118
GrpE [PF01025], Evalue: 4.3e-06, Aligned region: 30..81
Protein Sequence: 149 a.a.     [Download]
>gi|512650044|ref|YP_008108044.1| hypothetical protein H650_11145 [Enterobacter sp. R4-368]
MANSSPSLYETLYGNFTGGLDLHQVNEQNQAILSVLDNMQRILNCRAGTLKHLPDYGLPDMTKILQGMPG
TAHQLLQVFSDVLLKYEPRLKKITVVLLDQEIPGELRYAIDAELNGIGLVRYGTVFMPEGRVLLRHLKQQ
QYLDETDKL
 
Nucleotide Sequence: 450 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2179132-2178683 Enterobacter sp. R4-368, complete genome
ATGGCAAATAGTTCACCTTCATTATATGAAACGCTTTACGGTAATTTCACCGGCGGGCTTGATCTCCATC
AGGTCAATGAACAAAACCAGGCAATTTTGTCTGTGCTCGATAATATGCAACGTATCCTCAATTGTCGCGC
CGGGACGCTGAAGCATCTGCCGGATTATGGATTACCGGATATGACAAAAATTCTTCAGGGTATGCCGGGT
ACTGCTCACCAGTTGTTGCAGGTATTTTCTGACGTGCTACTCAAATACGAGCCGCGCCTGAAAAAAATAA
CCGTTGTGCTTCTCGATCAGGAAATCCCCGGTGAACTGCGCTACGCCATTGATGCTGAACTTAATGGTAT
TGGCCTGGTACGCTATGGCACAGTGTTTATGCCTGAGGGGCGTGTTTTGCTTCGTCATCTTAAACAACAG
CAGTATCTTGATGAGACAGATAAATTATAA