SecReT6
Protein ID: 512650050
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11175
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2183846..2186182 [-]
Producthypothetical protein
NoteTssI
UniProt IDR9VN84
KEGG IDenr:H650_11175
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.60E-57, Aligned region: 35..341
T6SS_Vgr [PF13296], Evalue: 6.70E-31, Aligned region: 473..578
DUF2345 [PF10106], Evalue: 2.60E-28, Aligned region: 605..729
Phage_base_V [PF04717], Evalue: 1.30E-11, Aligned region: 387..468
Sarcoglycan_1 [PF04790], Evalue: 0.0096, Aligned region: 592..635
Sarcoglycan_1 [PF04790], Evalue: 0.0096, Aligned region: 647..688
Sarcoglycan_1 [PF04790], Evalue: 0.0096, Aligned region: 658..698
Protein Sequence: 778 a.a.     [Download]
>gi|512650050|ref|YP_008108050.1| hypothetical protein H650_11175 [Enterobacter sp. R4-368]
MAKDNWLALFDGQTRYTLEINDSRVKPDVLNFYGREALSAPSKWRIEFTTSQSDVAADDVLLKYATLRML
SGRKVHGVITAFEWLGSTVDQTYYSVTLSSRLALLSHTRRCAVYQNLSVPELVAQVLRNHGLEGADVEFR
LQKRYPQRELITQWRESDLQFIRRILSEVGIWFCTGGNDVTGLDTVTFADGQQFYQYGQHLPYEEPSALY
DGAAESVWGLRTWHNTVTGMVRTRDYNYRKAGTPMDSAVSVRNNATTIGVHYRYAGPFLEVGEDSAIEPE
TESGAFYARLHHERELNKSTRLHLFSNAVGLMPGMVLEADGSNLNDLKDGMLMTLITYRAARDTRLHVSV
WGMPYSEQFCFRPQEEPRPHIHGTLPARIESREQGDIYAWLDNQGRYRVKMDFSREDAEPGYNYLWIRQA
KPCSGDTYGWHTPLTDGTEVGIAYEDGDIDRPYIAHAFHDSEHQDIVTRDNRSQNILRTAAGNELRMEDL
RGQEHIALTTPFGDTQLNQGHISDEQSKQRGSGFELRTDEYGVIRVAKGLFITADGQQKAVGEVLDMETA
LKEIDVCLQQLKALAAAAEQAQALEADIASQKAMFDQRLKPLNGMIHSHGPQGVAFTSGEHLQLAAGQNV
AVNAGGDFSSGAMGNAAILAGEGVGLFARTGSLTLNASEGPVQIQAQNGAMHLSAEQKLSLISASDILFA
GKKKVTLIGGGSYLVIDNGKVEYGTDMTYTRRIKRTHHTVPAAQPMDFPEISPTIMDKICIPCLLKAIQA
NDAIVQGA
 
Nucleotide Sequence: 2337 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2186182-2183846 Enterobacter sp. R4-368, complete genome
ATGGCGAAGGATAACTGGCTGGCACTGTTCGACGGGCAAACCCGCTACACGCTTGAGATAAATGACAGCC
GGGTAAAACCCGACGTGCTGAATTTTTACGGGCGTGAGGCGCTGAGTGCGCCATCGAAATGGCGCATTGA
GTTCACCACGTCGCAAAGCGATGTGGCGGCAGACGATGTACTGCTGAAATACGCCACGCTGCGCATGCTC
AGCGGGCGGAAAGTCCACGGCGTGATCACGGCGTTTGAATGGCTGGGTTCGACCGTTGACCAGACGTACT
ACAGCGTGACGCTCTCATCCCGCCTTGCGCTGCTTTCGCATACCCGGCGCTGTGCGGTATACCAGAACCT
TTCCGTACCGGAGCTGGTGGCACAGGTGCTGCGTAATCATGGTCTGGAAGGTGCGGATGTTGAGTTTCGT
CTGCAGAAGCGTTATCCGCAGCGCGAGCTCATCACTCAGTGGCGTGAAAGTGACCTGCAATTTATCCGGC
GAATTCTTTCAGAAGTCGGTATCTGGTTCTGTACCGGGGGGAATGATGTCACCGGGCTGGACACGGTGAC
CTTTGCCGACGGTCAACAGTTCTACCAGTATGGTCAGCATTTGCCGTACGAAGAACCGTCTGCGTTATAT
GACGGTGCGGCCGAATCGGTATGGGGTCTGCGCACCTGGCATAACACGGTGACCGGGATGGTGCGTACGC
GGGACTACAACTACCGCAAGGCAGGCACGCCGATGGATTCTGCTGTCAGCGTCAGAAACAATGCCACCAC
CATCGGTGTACACTACCGCTACGCCGGGCCATTTCTTGAAGTGGGCGAAGACAGCGCCATCGAACCGGAA
ACGGAAAGCGGGGCGTTTTATGCCCGACTTCACCACGAACGCGAACTGAATAAATCGACCAGGCTGCACC
TGTTCAGCAACGCCGTCGGGTTGATGCCGGGTATGGTGCTGGAAGCAGACGGCAGCAACCTTAACGACCT
GAAAGACGGCATGCTGATGACGCTTATCACCTATCGCGCCGCCCGCGACACGCGCTTGCATGTGTCAGTA
TGGGGAATGCCGTACAGCGAACAGTTCTGCTTCCGGCCACAGGAGGAACCCCGGCCACACATCCACGGCA
CGTTGCCGGCGCGTATTGAAAGCCGGGAGCAGGGCGATATCTATGCCTGGCTGGACAATCAGGGCCGTTA
CCGGGTGAAGATGGACTTCAGCCGCGAAGATGCGGAGCCGGGCTACAACTACCTGTGGATACGCCAGGCG
AAGCCCTGTTCCGGCGACACTTACGGCTGGCACACGCCGCTGACTGACGGCACGGAAGTTGGAATTGCCT
ATGAAGACGGTGATATCGACCGCCCGTATATTGCCCACGCCTTCCACGATTCAGAACATCAGGACATCGT
CACCCGCGATAACCGCAGCCAGAACATCCTGCGCACGGCAGCAGGCAACGAGCTACGAATGGAAGACCTG
CGTGGGCAGGAACATATTGCACTCACTACGCCATTCGGCGACACACAGCTCAACCAGGGCCATATCTCTG
ATGAGCAGAGCAAACAGCGGGGCTCCGGTTTTGAACTCAGAACGGATGAATACGGCGTCATCCGCGTGGC
GAAAGGACTGTTTATCACCGCTGACGGTCAGCAGAAGGCGGTGGGGGAGGTGCTGGACATGGAAACGGCG
CTGAAAGAAATCGACGTCTGCCTGCAGCAACTGAAAGCTCTGGCCGCTGCCGCAGAGCAGGCGCAGGCAC
TTGAAGCCGATATTGCCAGCCAGAAAGCGATGTTCGACCAGCGCCTGAAACCGCTGAACGGGATGATTCA
TTCCCATGGCCCGCAAGGCGTGGCCTTCACCAGCGGCGAACATCTGCAACTGGCTGCTGGTCAGAATGTG
GCAGTGAACGCGGGGGGAGATTTCAGCAGCGGAGCGATGGGGAATGCGGCAATTCTGGCCGGAGAAGGTG
TCGGTCTGTTCGCACGAACGGGTTCACTGACGCTGAACGCCAGCGAAGGTCCGGTGCAGATCCAGGCACA
GAACGGCGCAATGCACTTATCCGCAGAACAAAAGCTGAGCCTGATATCAGCGAGCGACATACTGTTCGCC
GGTAAGAAGAAGGTGACGCTGATCGGCGGCGGCAGCTATCTCGTCATCGACAACGGGAAGGTAGAGTACG
GCACGGATATGACCTATACGCGGAGGATAAAGCGGACGCATCATACCGTGCCTGCAGCACAGCCAATGGA
TTTCCCGGAAATTAGTCCGACGATAATGGATAAAATATGTATTCCGTGCCTGTTAAAAGCCATTCAGGCT
AATGATGCCATAGTGCAGGGAGCCTAA