SecReT6
Protein ID: 512650051
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11180
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2186188..2186712 [-]
Producthypothetical protein
NoteTssJ
UniProt IDR9VLM2
KEGG IDenr:H650_11180
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-34, Aligned region: 16..164
Protein Sequence: 174 a.a.     [Download]
>gi|512650051|ref|YP_008108051.1| hypothetical protein H650_11180 [Enterobacter sp. R4-368]
MTSVFLRQVVLLALSCLLSGCGLTQAVSDGAASMTKSIFYKKIKVLHLDFEPRSGVNADEAQTPLATMVR
VYQLRERQKVDAADYQMLLREADTVLKEDIVASKSLLVMPKGSVMLNMPMDEEAQYVAVIGLFNRPDLKN
NTWRLVLSRDDLDPDKPRTIELGSGFLTLIPVKE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2186712-2186188 Enterobacter sp. R4-368, complete genome
ATGACATCCGTTTTTCTACGACAGGTTGTTCTGCTCGCTCTCAGTTGTCTGCTGTCCGGTTGTGGCCTGA
CGCAGGCCGTCTCCGATGGTGCGGCCAGCATGACCAAATCTATCTTCTACAAAAAGATTAAGGTGTTGCA
TCTCGATTTTGAACCGCGCTCGGGAGTCAATGCCGATGAGGCGCAAACGCCGCTGGCGACGATGGTTCGT
GTCTACCAGCTAAGGGAACGCCAGAAGGTGGATGCCGCCGACTACCAGATGCTGCTGCGTGAAGCCGATA
CGGTGCTAAAGGAGGATATTGTGGCGAGCAAATCCCTGCTGGTGATGCCCAAAGGCAGCGTGATGCTCAA
TATGCCGATGGATGAAGAGGCGCAATATGTCGCGGTTATCGGGTTATTCAACCGCCCGGATTTGAAAAAC
AACACCTGGCGGCTGGTGCTGAGCCGCGATGACCTCGACCCGGACAAACCTCGCACCATTGAACTGGGTA
GCGGATTCCTGACGCTGATTCCTGTTAAGGAGTGA