SecReT6
Protein ID: 512650052
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11185
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2186745..2187824 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDR9VQA4
KEGG IDenr:H650_11185
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-82, Aligned region: 19..321
Protein Sequence: 359 a.a.     [Download]
>gi|512650052|ref|YP_008108052.1| type VI secretion protein [Enterobacter sp. R4-368]
MERESQPAGAGLTEKLGEDIWRVNFYRFCQLLEQENPDAPLLGTADKPTADPVRFRPWPGMGFPASELHT
VETDEEHPYLPPTVRTTFLGMYGVDSPLPTAYLDDIAQRREGYEATTAFLDIFSHRITTQYYRIWRKYAY
PATFEAGGSDETSQCLLGLVGLGIPGTAEQVATPVSRFLALLGAMRLPTRNAEGIRQLVSLLAPHTTATI
ISPDPIKVQVAQRSGLGKGNRVSLSQRATLGKTGKEACSRILLKLATSNPFEAEGWLPGGQLHTDLMVLL
RVYLGYRSDVRLRLTVPVGVLPEPRLGQKHRIQLGRTGILGLKRDKPGKRRNLTVSLGCYEGLDCQPLHP
AQDGGYRFD
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2187824-2186745 Enterobacter sp. R4-368, complete genome
ATGGAAAGAGAATCACAGCCAGCAGGTGCCGGGCTGACGGAAAAACTGGGCGAGGATATCTGGCGGGTTA
ACTTCTACCGGTTCTGCCAGTTGCTGGAGCAGGAGAATCCCGACGCACCATTACTGGGTACCGCCGACAA
ACCCACTGCCGACCCGGTGCGCTTTCGCCCCTGGCCGGGAATGGGGTTTCCGGCCAGCGAATTACACACC
GTTGAGACGGATGAAGAACATCCATATTTGCCACCGACGGTCCGCACGACCTTTCTTGGAATGTACGGCG
TGGATTCGCCGCTACCGACCGCTTATCTGGATGATATCGCCCAGCGGCGGGAAGGGTATGAAGCCACCAC
GGCCTTTCTCGATATCTTTAGCCACCGCATCACCACCCAGTACTACCGAATATGGCGTAAATACGCCTAC
CCGGCGACCTTTGAAGCAGGCGGCAGCGATGAGACGTCGCAATGCCTGCTGGGGCTGGTGGGCCTGGGGA
TCCCCGGTACGGCTGAACAGGTGGCTACCCCGGTTTCCCGTTTTCTGGCACTGCTCGGGGCGATGCGGCT
GCCAACCCGCAATGCGGAAGGTATTCGGCAACTGGTTAGCCTGCTGGCCCCGCATACCACCGCAACGATC
ATCAGCCCGGACCCTATCAAAGTGCAGGTGGCTCAGCGCAGTGGGCTGGGGAAAGGAAATCGAGTTTCCC
TGTCACAGCGCGCCACGCTCGGAAAAACCGGCAAAGAGGCCTGCAGCCGTATTCTGCTAAAGCTGGCAAC
CAGTAACCCGTTCGAAGCCGAAGGCTGGCTTCCGGGTGGCCAGCTACACACCGATCTGATGGTGCTGCTG
CGTGTATATCTGGGCTATCGCTCTGATGTGCGCTTGCGCCTGACTGTGCCGGTGGGTGTCTTGCCAGAAC
CGCGTCTCGGGCAAAAGCACCGCATCCAGCTTGGCCGTACCGGCATTCTGGGCTTGAAACGCGACAAACC
CGGCAAGCGCCGCAATCTGACCGTCAGCCTGGGGTGCTATGAGGGGCTGGATTGCCAACCCTTACATCCC
GCACAGGATGGCGGTTACCGTTTTGACTAA