SecReT6
Protein ID: 512650053
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11190
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2187788..2189557 [-]
Producttype VI secretion protein ImpG
NoteTssF
UniProt IDR9VKU5
KEGG IDenr:H650_11190
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.10E-184, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|512650053|ref|YP_008108053.1| type VI secretion protein ImpG [Enterobacter sp. R4-368]
MDDLTLRYYEAEMRYLREAGKEFARAHPDRAAMLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLSVVAFEPEWQQLKQAEILPEGFPVLSRPVGPDKTICQYRATRDITLQPIH
LADARLQTEPDGRAAIRLRFECASRVEWAKSGIDKVALYLDAESPVASALHLALTRRVHAIYARHVAART
ERIRFDGWCKPMGFEDSERLWPKGDSAFSGYQLLLEYFSFRQKFMFVELRGLELIGLNQDTTWFETDIVL
DGGWPSDMPFETENFRLHCAPVINLFTLEADPLTIDPLENEYLLRPLRVQDGHTEIYSVDNIHGAVKNGK
HPYVPFTSFRHRGGMMRFDAPERYFHTRVKRGPSGLYDTWLILGGRSFEMEQLAEKPESLSIRITGTNGQ
LPRKALESTLLDRVVKAGKVAVKVRNLCAPTLPLYPPANDRFHWRVMSHLGSSFLSMMDNPEVLRGTLAL
YDWTDDEMNRRRLEAIVAVKHTLVRRFERGYMLRGVEIEITLNADNFAGEGDVNLFGEMLHRFFALYADV
HLFNQLTLVLQPTGKRLRWKENHSQQVPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2189557-2187788 Enterobacter sp. R4-368, complete genome
ATGGATGATTTAACCCTGCGCTATTACGAAGCAGAGATGCGTTACCTGCGCGAAGCCGGTAAAGAATTTG
CCCGCGCCCATCCCGATCGCGCAGCCATGCTCAATCTGGATAAAGCCGGTGCCCGCGACCCGTACGTCGA
GCGCCTGTTCGAAGGGTTTGCCTTCCTGATGGGACGCCTGCGTGAAAAGCTCGACGATGATCTGCCTGAG
CTGACCGAAGGGCTGGTGAGCCTGCTCTGGCCGCACTATATGCGCACCATTCCGTCACTCTCCGTAGTGG
CGTTCGAACCGGAATGGCAGCAGCTTAAACAGGCTGAAATTCTGCCTGAAGGCTTCCCGGTGCTGTCGCG
TCCGGTTGGTCCTGACAAGACCATCTGCCAGTACCGCGCGACCCGGGATATCACCCTGCAGCCGATTCAT
CTGGCAGATGCCCGTTTGCAGACCGAGCCTGACGGGCGTGCCGCCATTCGCCTGCGTTTTGAGTGTGCCA
GCAGGGTGGAGTGGGCCAAAAGTGGCATTGATAAAGTTGCCCTCTACCTTGATGCCGAAAGCCCGGTGGC
ATCCGCGTTGCATCTGGCGCTGACCCGCCGGGTGCATGCGATTTACGCCCGTCACGTTGCGGCCCGCACC
GAGCGCATCCGCTTTGACGGTTGGTGTAAGCCGATGGGCTTCGAAGATAGTGAGCGTCTGTGGCCGAAAG
GCGACTCTGCGTTCAGTGGCTACCAGCTACTGCTGGAGTATTTCAGCTTCCGGCAGAAGTTTATGTTTGT
CGAGCTGCGTGGGCTGGAGTTGATTGGGCTCAACCAGGATACCACCTGGTTTGAAACCGACATCGTGCTA
GATGGCGGCTGGCCGTCCGATATGCCGTTTGAAACCGAAAATTTCCGCCTGCATTGCGCGCCGGTGATTA
ATCTTTTTACGCTGGAAGCCGACCCGCTGACCATCGACCCTTTGGAAAACGAATACCTGCTGCGCCCGCT
GCGTGTGCAGGACGGCCACACGGAAATCTACAGCGTCGATAATATTCACGGCGCGGTAAAAAATGGCAAA
CACCCTTACGTACCGTTCACCAGCTTCCGCCATCGCGGCGGCATGATGCGCTTTGACGCGCCGGAGCGCT
ATTTCCACACCCGCGTGAAACGTGGCCCGTCCGGGCTGTATGACACCTGGCTTATTCTCGGCGGCCGTTC
GTTTGAGATGGAGCAGCTCGCTGAAAAGCCGGAATCGCTCTCCATTCGTATCACTGGCACTAACGGGCAA
CTGCCCCGCAAGGCGCTGGAAAGCACACTGCTCGACCGGGTAGTGAAAGCCGGAAAAGTGGCGGTGAAGG
TGCGGAATCTCTGCGCGCCAACATTGCCACTTTATCCGCCAGCAAATGATCGCTTCCACTGGCGGGTGAT
GAGTCATCTGGGATCCAGCTTTCTGAGCATGATGGATAACCCGGAAGTGCTGCGCGGCACGCTGGCGCTG
TATGACTGGACCGATGATGAGATGAACCGACGCCGTCTGGAAGCCATTGTGGCGGTGAAGCATACGCTGG
TGCGCCGTTTTGAACGTGGCTACATGCTGCGCGGCGTCGAGATTGAAATCACGCTTAATGCCGACAACTT
TGCCGGCGAGGGGGATGTGAATCTGTTTGGTGAAATGCTGCACCGCTTCTTTGCGCTGTATGCCGATGTT
CACCTCTTCAATCAGCTCACGCTGGTGCTGCAACCGACAGGGAAACGACTGCGATGGAAAGAGAATCACA
GCCAGCAGGTGCCGGGCTGA