SecReT6
Protein ID: 512650054
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11195
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2189616..2191226 [-]
Producthypothetical protein
NoteTssA
UniProt IDR9VQL8
KEGG IDenr:H650_11195
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.60E-18, Aligned region: 73..129
ImpA-rel_N [PF06812], Evalue: 4.60E-18, Aligned region: 158..184
Protein Sequence: 536 a.a.     [Download]
>gi|512650054|ref|YP_008108054.1| hypothetical protein H650_11195 [Enterobacter sp. R4-368]
MATAKALLALCVPDEAQQSALLVHQQASLSQWDNWLKPLTGSDGAGEDPAYDDDFQLMREEINKLSGTDP
ETLCQLAEKILCHTARDLRVVTWYIFARLQKEGETGLCQGLQLLAAILTRYGEHCYPLRPNARKSALEWL
NSTKVQDALSLWPDANREQTSQTAAVMSLLDSQLENWPEGERPSLDGLSRALEIRLAGSGGLDGLMSQTT
STDESTPVSTVRQSAPDMVVTSEGEFLSQSKVLSRWLADQQDGWLASHRLMKVVRWDTVGQIPALDASGR
TRLSPPKPDYRAQLKRLYLQQNWTELVEQASTMFCEGGNRFWLDLQWYLWQGLTRAGQPWDSWADYILSD
LKLLLARLHGLEQLSWSDGTPFADEVTLIWIAEKVNDDMPGFGNQPAAVASGGQPDDILALEAEAMEKGD
RDGPEAALGWLQHRSGMESPRSRWLLRLLMARVAEQFGRNEMALHLLGELTSSAPQLTLNDWEPALLFEV
QARRLKLLRLKAGRSESDKTRLAPEMDELLAGLIAIDPARAMVLCG
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2191226-2189616 Enterobacter sp. R4-368, complete genome
ATGGCTACTGCAAAAGCGCTGCTGGCGCTGTGTGTTCCCGACGAAGCGCAGCAGTCAGCGCTGCTCGTCC
ATCAGCAGGCCAGCCTGTCACAATGGGATAACTGGCTCAAGCCATTAACGGGCAGTGACGGGGCGGGGGA
AGACCCTGCCTATGACGACGATTTCCAGTTGATGCGCGAGGAAATCAACAAACTTTCTGGCACCGATCCG
GAAACGCTTTGCCAGCTGGCTGAAAAAATACTCTGTCACACCGCCCGCGACTTAAGGGTGGTCACCTGGT
ATATCTTCGCCCGTCTGCAAAAGGAAGGTGAGACCGGCCTGTGTCAGGGGCTGCAACTGCTGGCGGCGAT
ACTGACCCGCTACGGTGAGCACTGTTATCCGCTTCGCCCCAATGCACGCAAATCTGCGCTTGAGTGGCTA
AACAGTACAAAGGTGCAGGACGCGCTTTCACTATGGCCGGATGCCAACCGGGAGCAAACCTCGCAGACGG
CAGCCGTGATGAGTTTGCTGGATAGCCAACTGGAAAACTGGCCGGAGGGCGAACGCCCCTCTCTCGACGG
TTTATCCCGCGCGCTGGAAATCCGTCTGGCAGGCTCCGGCGGGCTGGATGGCTTAATGTCGCAAACTACC
AGCACAGACGAAAGTACGCCTGTTTCAACGGTCAGGCAGTCCGCCCCGGACATGGTTGTTACGTCTGAGG
GGGAATTTTTAAGCCAGTCAAAAGTGCTCTCCCGCTGGCTGGCCGATCAGCAGGATGGCTGGCTGGCGTC
ACACCGGCTGATGAAAGTGGTTCGCTGGGATACTGTGGGGCAAATCCCGGCTCTGGATGCCAGTGGTCGT
ACCCGTCTTTCACCACCCAAACCGGATTATCGCGCGCAGCTGAAGCGCCTGTATCTGCAGCAGAACTGGA
CGGAACTGGTGGAGCAGGCCAGCACCATGTTCTGCGAAGGGGGGAACCGCTTCTGGCTCGATCTGCAATG
GTATCTCTGGCAAGGGCTGACCCGCGCCGGACAACCATGGGATAGCTGGGCGGACTATATCCTTAGCGAT
CTGAAGCTGCTGCTGGCCCGTTTGCATGGCCTCGAACAGCTCTCCTGGAGTGACGGCACGCCGTTTGCTG
ATGAAGTAACGCTGATCTGGATTGCTGAGAAGGTGAACGATGATATGCCGGGGTTTGGCAATCAACCCGC
CGCGGTTGCCAGCGGCGGGCAACCAGATGACATTCTCGCGCTGGAAGCCGAGGCGATGGAAAAGGGGGAC
CGCGACGGCCCGGAGGCTGCGCTAGGTTGGCTTCAGCATCGCTCTGGCATGGAATCTCCCCGTAGCCGCT
GGTTGTTGCGTCTGCTGATGGCCCGTGTTGCCGAACAGTTCGGACGCAATGAAATGGCACTCCACCTGCT
CGGTGAACTCACCAGTAGCGCACCACAGCTGACGCTTAACGACTGGGAGCCTGCGCTGCTGTTTGAGGTG
CAGGCGCGCCGCCTGAAGCTGTTACGCCTGAAAGCGGGGCGTAGCGAAAGCGATAAAACCCGCCTCGCCC
CTGAAATGGACGAGCTGCTGGCTGGCCTCATTGCTATCGATCCCGCCCGGGCGATGGTGCTGTGCGGCTG
A