SecReT6
Protein ID: 512650059
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11220
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2200334..2202691 [-]
Producthypothetical protein
NoteTssI
UniProt IDR9VQM3
KEGG IDenr:H650_11220
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-60, Aligned region: 41..355
Phage_GPD [PF05954], Evalue: 2.50E-60, Aligned region: 468..506
DUF2345 [PF10106], Evalue: 2.10E-42, Aligned region: 605..755
T6SS_Vgr [PF13296], Evalue: 5.10E-34, Aligned region: 486..591
T6SS_Vgr [PF13296], Evalue: 5.10E-34, Aligned region: 634..654
Phage_base_V [PF04717], Evalue: 4.10E-14, Aligned region: 402..481
Protein Sequence: 785 a.a.     [Download]
>gi|512650059|ref|YP_008108059.1| hypothetical protein H650_11220 [Enterobacter sp. R4-368]
MSDSVITPAKEKIDTLLGMSRYKLVVHDCPHFLDVFNFKAEEKLSEPWHYTVKVTCTESDIASDSMLLKP
ASFTLQVPLYNGMPATPLRTVYGVVQTFQRLSTSADETWYTLKIVPRIALLQYTKRSEIYLNQSVVEVVE
KILRFHGLEGADFEFRLTQDYPARELITQWRETDLEFVQRLLAEVGIFWRFEMDARLEQDVVVFQDSPEQ
YQFGVTLPLIPPSRTNDNGQLCVWDIKTGHQVVSESVANRDYNYREALTPQDSSASVSTTDGITTGEVYH
YAEPFLSKGDIETPESGAYYARLRHERILNAQQKVTGKTTSPVLVPGEVLEPQGALPANLKGGIVITGVQ
SRGSRKQSFKMTFTGIPYSEAVCYRPQLHRRPVIAGTLPARVESTEKGDTYAWLDNQGRYRTKLNFDRSD
SEQGYAYLWLRMAKPYAGDNYGFHAPLLDGTEVSVMFDAGDPDRPYIAHAQHDSEHPDHVTNDNHTRNVL
RTPANNKLRMEDKRQQEHIKLATEFGKTQLNIGHLVDAQREKRGAGFELRTDEFGAVRAARGIYLTADAQ
AKGQGQVLEMNPAVSQIIQANSEMQALNGAAEQAKALTCDIQTQNNLLQKRLKDLQSAVVLASAPQGIAL
TSGEHLQLTSTKNTMLTAGQHVDIGAMKNVTVSAEQSLGLFAHKGGAKVIANQGNVEIRAQYSTLEMSAD
QQFTITSSKDEITISTPKTLTLNGGGSYLKLSESGIEHGTKGDFITRASNYLVPGTGKTIPAETPDFKKT
DISVTGKNSAKWASE
 
Nucleotide Sequence: 2358 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2202691-2200334 Enterobacter sp. R4-368, complete genome
ATGAGTGATTCCGTAATTACCCCGGCGAAGGAAAAAATCGACACATTACTGGGTATGTCTCGCTATAAGC
TGGTCGTTCACGACTGCCCGCACTTTCTGGATGTCTTCAATTTTAAGGCAGAAGAAAAACTCAGCGAACC
GTGGCACTACACCGTTAAAGTGACCTGTACTGAAAGCGATATCGCCAGCGACAGCATGCTGCTTAAACCG
GCATCCTTCACGCTCCAGGTTCCACTGTATAACGGTATGCCAGCCACGCCATTGCGTACTGTCTATGGCG
TCGTGCAGACATTCCAGCGTCTTTCGACGTCTGCCGATGAAACCTGGTATACGCTGAAAATTGTGCCGCG
CATCGCGCTGTTGCAGTACACAAAGCGCAGCGAGATTTACCTTAATCAGTCCGTTGTTGAAGTCGTGGAG
AAGATCCTGCGTTTCCACGGGCTGGAAGGGGCTGATTTTGAGTTCCGTCTGACGCAGGATTATCCGGCAC
GTGAACTGATCACCCAGTGGCGTGAAACCGACCTCGAATTTGTGCAGCGTTTACTGGCCGAAGTCGGCAT
CTTCTGGCGCTTTGAAATGGATGCCCGCCTCGAACAGGATGTGGTGGTTTTCCAGGACAGCCCGGAGCAG
TATCAGTTTGGTGTAACGCTGCCGCTCATCCCTCCATCACGAACCAACGATAACGGGCAGCTCTGCGTAT
GGGATATTAAAACCGGCCATCAGGTGGTGTCAGAAAGCGTAGCCAACCGTGATTACAACTACCGCGAGGC
GCTGACGCCACAGGACAGTTCTGCGTCTGTCAGTACCACGGATGGCATCACCACGGGTGAGGTGTATCAC
TACGCAGAGCCTTTTCTGAGCAAAGGCGATATCGAAACCCCGGAGAGTGGGGCGTACTATGCCCGTTTGC
GTCATGAACGTATTCTGAATGCGCAGCAGAAAGTCACTGGTAAAACAACCAGCCCGGTGCTGGTGCCGGG
CGAAGTACTTGAACCGCAGGGGGCGCTTCCTGCCAACCTGAAAGGCGGCATTGTTATCACCGGTGTGCAA
AGCCGTGGTTCGCGTAAGCAAAGTTTTAAGATGACCTTTACCGGCATCCCTTACAGCGAGGCCGTGTGTT
ATCGCCCGCAGCTTCATCGTCGCCCGGTGATTGCCGGTACATTGCCTGCTCGTGTGGAGAGCACCGAGAA
AGGCGATACCTATGCCTGGCTGGACAATCAGGGCCGCTATCGCACGAAACTGAATTTCGATCGCAGCGAC
AGCGAACAGGGTTATGCCTATCTGTGGCTGCGTATGGCGAAACCGTATGCCGGAGACAATTACGGTTTCC
ACGCGCCGTTGCTCGACGGCACCGAAGTTTCGGTGATGTTCGATGCGGGGGACCCTGACCGTCCGTATAT
TGCCCATGCCCAGCACGATTCTGAACACCCGGATCACGTCACTAACGATAACCACACGCGAAACGTTCTG
CGAACGCCTGCGAACAATAAACTCCGCATGGAAGATAAGCGCCAGCAAGAGCACATCAAGCTTGCGACGG
AGTTCGGCAAAACCCAGCTCAATATCGGCCATCTGGTTGATGCCCAACGCGAAAAGCGCGGTGCGGGTTT
TGAGCTACGCACCGATGAGTTTGGTGCCGTGCGTGCTGCCCGTGGGATTTACCTGACAGCGGATGCGCAG
GCCAAAGGCCAGGGGCAAGTGCTGGAGATGAATCCGGCGGTCAGCCAGATTATTCAGGCCAACAGCGAGA
TGCAGGCGCTGAACGGCGCTGCTGAACAGGCGAAAGCCCTGACATGTGATATTCAAACGCAGAACAATTT
GCTCCAGAAGCGCCTGAAAGATTTGCAGTCTGCCGTGGTACTGGCTTCTGCTCCGCAAGGAATTGCCCTT
ACCTCTGGTGAGCATCTGCAACTGACCAGCACGAAAAATACCATGCTTACCGCAGGGCAGCATGTCGATA
TCGGAGCAATGAAAAATGTCACGGTGAGTGCTGAACAATCTTTGGGGCTATTTGCCCATAAAGGTGGGGC
GAAGGTCATTGCGAATCAGGGCAACGTAGAAATACGCGCCCAGTACAGCACACTCGAGATGAGCGCTGAC
CAGCAGTTCACGATCACCAGCAGTAAAGATGAAATCACCATCAGCACTCCGAAAACCCTGACGCTGAACG
GTGGTGGTTCCTACCTGAAACTAAGCGAAAGCGGAATTGAGCATGGAACAAAGGGGGACTTTATTACCAG
GGCTTCGAATTATCTTGTCCCTGGAACAGGGAAGACCATTCCCGCTGAAACCCCAGATTTTAAAAAAACC
GATATTAGTGTTACCGGGAAAAATTCAGCCAAATGGGCCAGTGAATAA