SecReT6
Protein ID: 512650061
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11230
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2203631..2206270 [-]
ProductATPase
NoteTssH
UniProt IDR9VLN8
KEGG IDenr:H650_11230
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.70E-41, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 2.70E-41, Aligned region: 610..775
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 238..350
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 615..736
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 763..780
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 336..368
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 614..735
AAA_16 [PF13191], Evalue: 7.30E-14, Aligned region: 104..104
AAA_16 [PF13191], Evalue: 7.30E-14, Aligned region: 215..259
AAA_16 [PF13191], Evalue: 7.30E-14, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 7.30E-14, Aligned region: 584..650
AAA_16 [PF13191], Evalue: 7.30E-14, Aligned region: 678..708
AAA_16 [PF13191], Evalue: 7.30E-14, Aligned region: 753..806
ClpB_D2-small [PF10431], Evalue: 5.70E-13, Aligned region: 781..855
AAA_22 [PF13401], Evalue: 1.80E-09, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 1.80E-09, Aligned region: 611..655
AAA_25 [PF13481], Evalue: 1.60E-07, Aligned region: 238..262
AAA_25 [PF13481], Evalue: 1.60E-07, Aligned region: 292..326
AAA_25 [PF13481], Evalue: 1.60E-07, Aligned region: 609..643
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 216..253
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 290..387
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 609..634
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 684..696
IstB_IS21 [PF01695], Evalue: 3.20E-06, Aligned region: 232..261
IstB_IS21 [PF01695], Evalue: 3.20E-06, Aligned region: 614..632
AAA_19 [PF13245], Evalue: 4.20E-06, Aligned region: 235..261
AAA_19 [PF13245], Evalue: 4.20E-06, Aligned region: 610..636
NACHT [PF05729], Evalue: 7.40E-06, Aligned region: 238..268
NACHT [PF05729], Evalue: 7.40E-06, Aligned region: 614..635
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 238..301
AAA_17 [PF13207], Evalue: 2.00E-05, Aligned region: 613..649
Zeta_toxin [PF06414], Evalue: 2.90E-05, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 2.90E-05, Aligned region: 611..654
Sigma54_activat [PF00158], Evalue: 5.80E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 5.80E-05, Aligned region: 614..731
AAA_14 [PF13173], Evalue: 8.10E-05, Aligned region: 238..328
AAA_14 [PF13173], Evalue: 8.10E-05, Aligned region: 612..696
AAA_29 [PF13555], Evalue: 0.00014, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 0.00014, Aligned region: 611..640
Clp_N [PF02861], Evalue: 0.00047, Aligned region: 22..53
Clp_N [PF02861], Evalue: 0.00047, Aligned region: 108..122
AAA_18 [PF13238], Evalue: 0.00057, Aligned region: 238..258
AAA_18 [PF13238], Evalue: 0.00057, Aligned region: 445..500
AAA_18 [PF13238], Evalue: 0.00057, Aligned region: 615..639
AAA_23 [PF13476], Evalue: 0.001, Aligned region: 238..255
AAA_23 [PF13476], Evalue: 0.001, Aligned region: 442..530
AAA_23 [PF13476], Evalue: 0.001, Aligned region: 611..638
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 712..733
DUF258 [PF03193], Evalue: 0.0023, Aligned region: 224..255
DUF258 [PF03193], Evalue: 0.0023, Aligned region: 613..626
SRP54 [PF00448], Evalue: 0.0032, Aligned region: 238..260
SRP54 [PF00448], Evalue: 0.0032, Aligned region: 613..645
AAA_33 [PF13671], Evalue: 0.0053, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.0053, Aligned region: 423..447
AAA_33 [PF13671], Evalue: 0.0053, Aligned region: 613..632
AAA_33 [PF13671], Evalue: 0.0053, Aligned region: 733..800
Protein Sequence: 879 a.a.     [Download]
>gi|512650061|ref|YP_008108061.1| ATPase [Enterobacter sp. R4-368]
MENSAALLRRLNPYCACALEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDSMWQALL
DWLDRLPRSVRSRPQLASSLNTLLKQAWMIASLQDEEKIRSLHLLIALVESPTLIHCDGLWPLLTLGQSQ
LERLRPLLDAQSDERPDVQQEAELTQSYSGDIEMVGRPVGAEVKEGELSAALQNALDKFTLDVTAKAKAG
KIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPESLKPVVLRTLDLGLL
QAGAGVKGEFEQRLKNVIDAVQQSPVPILLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAGHHNVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTASARVRMSLDTVPERLTRLRSQITALDMEKQALLEDTAVGNQSPGERLAALEQEDVRLR
AELDELEIRYGQELELTEQLLASRQDISRQSEICTLQQELSGIQHNNPLLSVDVDVRTVANVIADWTGVP
LSSLMKDEQTELLSLENEISKRVVGQDVALTAIAQRLRAAKTGLTSGNGPQGVFLLVGPSGVGKTETALA
LADVLYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHLMQRLDEQPEASEGDLHELLRPILRDHFQPALL
ARFQTVIYRPLAHAAMRTIVEMKLTQVSKRLYRHYGLITNIDEALYDALTAACLLPDTGARNVDSLLNQQ
ILPVLSQQLLTHMAARQKPKMLTFGWSEDEGIELVFGVR
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2206270-2203631 Enterobacter sp. R4-368, complete genome
ATGGAAAACTCAGCCGCCCTGTTACGTCGCCTTAATCCTTACTGCGCCTGTGCGCTGGAAGGGGCGGCCT
CCCTGTGCCAGACCCGCGCCCATGCGGAAATTCTGCCGGAACACTGGCTGCTGAAACTGCTGGAGCAGGG
CGAAGGTGACCTGACGGTGCTGGCGCGTCGCTACGAGTGGGATATGGACAGTATGTGGCAGGCGCTGCTG
GACTGGCTGGACAGGCTTCCGCGATCGGTACGCAGCCGGCCACAGCTGGCGAGCTCTCTCAACACGCTGC
TGAAACAGGCATGGATGATAGCGTCATTGCAGGACGAAGAAAAAATCCGCAGCCTGCATCTGCTGATTGC
GCTGGTTGAAAGCCCGACGCTGATTCATTGTGATGGTCTGTGGCCCCTGCTGACGCTGGGCCAGAGCCAG
CTGGAGCGCCTTCGCCCGCTGCTGGATGCGCAGTCTGACGAACGCCCGGACGTGCAGCAGGAAGCAGAAC
TGACCCAGAGCTACAGTGGCGATATTGAAATGGTCGGCCGCCCTGTGGGGGCAGAGGTAAAAGAGGGCGA
ACTGAGTGCGGCGCTGCAGAACGCGCTGGATAAATTCACCCTTGATGTCACCGCCAAAGCGAAAGCGGGC
AAAATCGACCCGGTGTTTGGTCGTGACACTGAAATCCGCCAGATGGTGGATATCCTCTCCCGACGTCGTA
AAAACAACCCGATTCTGGTCGGCGAGCCCGGAGTCGGAAAAACCGCACTGGTTGAAGGCCTCGCGCTGCG
CATTGCCGAAGGCAACGTGCCTGAATCGCTCAAACCTGTCGTTCTGCGCACCCTCGATCTTGGGTTGTTA
CAGGCGGGCGCAGGTGTGAAGGGAGAATTCGAACAGCGCCTGAAAAACGTTATCGACGCCGTACAGCAGT
CGCCGGTGCCGATTCTGCTGTTTATCGACGAAGCGCACACCATCATTGGCGCGGGCAACCAGGCAGGTGG
CGCGGATGCGGCGAATCTGCTGAAACCGGCGCTGGCACGTGGCGAATTACGAACAATTGCCGCGACCACC
TGGTCTGAATACAAACAATACTTCGAGCGTGACGCCGCGCTGGAACGCCGCTTTCAGATGGTGAAAGTGG
ATGAGCCCGACGACGACACCGCCTGCCTGATGCTGCGTGGCCTGAAATCCCGCTACGCCGGGCACCATAA
CGTGCATATCACGGACGATGCGGTGCGCGCCGCTGTGACGCTTTCCCGCCGTTATCTGACAGGCCGTCAG
CTGCCGGACAAAGCCGTTGATCTCCTCGATACCGCCAGCGCCCGCGTGCGCATGAGCCTCGACACCGTGC
CGGAACGGCTGACCCGTCTTCGCTCGCAAATTACAGCGCTGGACATGGAGAAGCAGGCGCTGCTGGAAGA
TACCGCAGTCGGTAATCAGAGCCCCGGTGAACGCCTGGCGGCGCTTGAGCAGGAAGACGTGCGGCTGAGG
GCTGAACTCGACGAACTGGAGATCCGGTACGGTCAGGAGCTGGAACTCACCGAACAACTGCTGGCGAGCC
GCCAGGATATCTCCCGCCAGAGTGAAATCTGCACGCTGCAGCAGGAGCTGAGCGGCATCCAGCACAACAA
TCCGCTGCTCTCCGTGGATGTGGATGTACGTACCGTCGCTAACGTCATTGCCGACTGGACGGGGGTGCCG
TTGTCATCTCTGATGAAAGACGAGCAGACCGAACTGCTGAGCCTGGAAAATGAAATCAGCAAACGTGTGG
TCGGGCAGGATGTCGCGCTTACCGCCATCGCGCAACGCCTGCGGGCGGCGAAAACAGGCCTCACTTCCGG
GAACGGTCCGCAGGGCGTGTTCCTGTTGGTTGGCCCGAGCGGCGTGGGTAAAACCGAAACGGCACTGGCG
CTCGCCGATGTGCTCTACGGCGGCGAAAAGTCGCTGATTACCATCAACCTGTCCGAATACCAGGAGCCGC
ACACGGTTTCCCAGTTGAAAGGATCGCCTCCGGGCTACGTCGGTTACGGTCAGGGCGGTATCCTGACCGA
AGCGGTGCGCAAGCGGCCGTACAGCGTGGTGCTGCTGGATGAAGTGGAGAAAGCCCACCGTGACGTGATG
AACCTGTTCTATCAGGTTTTCGACCGCGGGTTTATGCGCGACGGCGAAGGCCGCGAAATCGACTTTCGCA
ACACCGTTATTCTGATGACCTCGAACCTCGGCAGCGACCACCTGATGCAACGGCTTGATGAACAGCCGGA
AGCCAGCGAAGGCGATCTGCACGAGCTGTTGCGCCCGATCCTGCGTGACCATTTCCAGCCTGCGCTGCTC
GCCCGCTTCCAGACGGTGATTTACCGTCCGCTGGCGCATGCTGCTATGCGCACCATCGTGGAAATGAAAC
TCACCCAGGTGAGCAAACGTCTGTATCGCCATTACGGTCTGATCACTAACATTGACGAGGCGCTGTATGA
CGCCCTGACCGCCGCCTGTCTGCTGCCGGATACGGGCGCGCGCAACGTCGATAGCTTACTCAACCAGCAA
ATTCTGCCGGTTCTGAGCCAGCAGTTGCTTACCCATATGGCCGCGAGGCAGAAACCGAAAATGCTGACGT
TTGGCTGGAGTGAGGACGAGGGCATTGAACTGGTGTTTGGTGTCAGGTAA