SecReT6
Protein ID: 512650064
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11245
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2208621..2209346 [-]
Producthypothetical protein
NoteTssL
UniProt IDR9VQM9
KEGG IDenr:H650_11245
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-40, Aligned region: 7..229
Protein Sequence: 241 a.a.     [Download]
>gi|512650064|ref|YP_008108064.1| hypothetical protein H650_11245 [Enterobacter sp. R4-368]
MRKDIDIDDLMADSWLTVSQLRHAARAPDGKALYKNCCAQVESVREALEHAGYDSESIAHITYAQCALLD
EAVMNRKSVPAGTEADSSDSESATVAPQKADMDEGIKAWRAAPLQARYFGSLRAGGALYDRIAEVLRQPS
PVPAVLTCYQRVLALGFQGQFAFSGAGQTQREEVIAALNERVPPLETSVDLVVQKTGKRRYNILRSVWFW
IILAALVTALVWAGGHLWLKDLLRQQLPELR
 
Nucleotide Sequence: 726 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2209346-2208621 Enterobacter sp. R4-368, complete genome
ATGAGAAAGGATATCGATATCGACGACCTGATGGCGGACTCCTGGCTCACCGTGTCTCAACTGCGTCACG
CCGCCAGAGCGCCGGATGGCAAGGCGCTCTATAAAAACTGTTGTGCCCAGGTGGAGAGTGTACGCGAAGC
GCTGGAGCACGCTGGTTACGACAGCGAGAGCATCGCACATATTACCTATGCGCAGTGTGCCCTGCTGGAT
GAAGCGGTGATGAACCGTAAATCTGTGCCTGCTGGAACAGAGGCGGATTCGTCGGACTCTGAATCTGCAA
CAGTGGCACCGCAGAAGGCTGACATGGACGAAGGCATCAAAGCCTGGCGCGCAGCGCCGTTGCAGGCCCG
TTACTTTGGCTCGCTGCGTGCGGGTGGTGCTTTATATGACCGCATTGCGGAAGTGCTGCGTCAGCCGTCA
CCGGTTCCTGCGGTGCTGACTTGCTACCAGCGTGTTCTTGCGTTGGGGTTCCAGGGGCAGTTTGCCTTCT
CTGGTGCCGGACAGACCCAGCGAGAAGAGGTGATTGCCGCTCTTAATGAGCGCGTACCACCGCTGGAGAC
TAGCGTTGATCTGGTCGTACAGAAAACCGGTAAGCGCCGCTACAACATTCTGCGCTCCGTATGGTTCTGG
ATAATCCTGGCGGCACTTGTCACTGCACTGGTCTGGGCTGGCGGTCACCTGTGGTTGAAGGATCTTCTGC
GCCAGCAATTACCGGAGTTGCGCTGA