SecReT6
Protein ID: 512650065
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11250
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2209343..2210692 [-]
Producthypothetical protein
NoteTssK
UniProt IDR9VN93
KEGG IDenr:H650_11250
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-125, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|512650065|ref|YP_008108065.1| hypothetical protein H650_11250 [Enterobacter sp. R4-368]
MKIYRPLWNEGALLAPQQFQQQSGWESFSRAGLSRLYSPFPWGVERVEFNDALLASGRVQVQTLRLWLPD
GTLVDTQNSDLPPEPREVALPDSGQVESVTVLIALPVMQPGIVNVQMETVSAERPLRYREEWVAVQDLFG
QEEEPMAVARFNLAFRFDHESNDAWQTCAVARLLRDGQGGWRQDPDFVPPMAMFSASSLLRERLVLLNRQ
LRSRRQRLMAMRRESNDRMADFAVADVSLFWLLNALNTHARVLTEFERFPARHPEQVWAELARLAGSLLT
FSLDRDLDAIPGYDHHAPENTFPPLFELISELLEASLPSRVVAVNMTRLDEQTWKAVLHDIRLREEADFY
LSVRSNLPAWQVAEKFTEMAMAGTPDDVGQITSVAMEGIGLIPLTRVPAALPVRLENQYFVLDMESRAAQ
EMLEQGVCLFYVPSLLGELELELFAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2210692-2209343 Enterobacter sp. R4-368, complete genome
ATGAAGATCTATCGTCCGTTATGGAATGAAGGGGCCTTGCTGGCCCCTCAGCAGTTCCAGCAGCAGTCCG
GGTGGGAATCTTTTTCCCGTGCCGGATTATCCCGGCTTTACAGCCCCTTTCCGTGGGGGGTTGAGCGAGT
CGAGTTCAATGACGCCCTTCTCGCGTCTGGTCGGGTGCAGGTGCAGACCCTGCGTCTGTGGCTGCCGGAT
GGCACACTGGTTGACACACAAAACAGTGATTTACCGCCTGAGCCGAGAGAAGTGGCGCTGCCGGACTCCG
GTCAGGTGGAGAGTGTGACCGTGCTGATTGCGCTGCCAGTGATGCAACCCGGCATTGTTAATGTCCAGAT
GGAAACAGTGTCTGCCGAACGTCCGCTGCGCTATCGCGAAGAGTGGGTGGCCGTTCAGGATCTATTCGGT
CAGGAAGAAGAGCCAATGGCCGTGGCCCGTTTCAATCTCGCGTTCCGCTTTGATCACGAAAGTAACGATG
CCTGGCAGACCTGTGCCGTAGCTCGTCTGTTGCGTGATGGGCAGGGTGGCTGGCGTCAGGATCCGGACTT
TGTGCCACCGATGGCAATGTTCTCTGCAAGCAGCCTGTTACGTGAACGTCTGGTGCTGCTGAACCGCCAG
TTGCGTTCCCGACGCCAGCGTCTGATGGCGATGCGTCGCGAGAGCAATGACCGCATGGCAGACTTTGCGG
TTGCCGATGTCTCGCTGTTCTGGTTGCTGAATGCGCTAAATACGCATGCCCGTGTTTTGACTGAGTTCGA
ACGCTTCCCGGCTCGTCACCCTGAACAGGTATGGGCAGAGCTGGCGCGACTTGCCGGCAGCCTGCTGACG
TTTTCGCTGGATCGCGATCTGGATGCGATCCCGGGCTATGACCATCACGCTCCGGAAAACACCTTCCCGC
CGTTATTTGAACTTATCAGTGAGCTACTGGAAGCCAGTCTGCCGTCGCGCGTGGTTGCCGTGAATATGAC
CCGCCTGGACGAGCAAACCTGGAAAGCGGTGTTGCACGATATCCGTCTGCGCGAAGAAGCCGATTTTTAC
CTGTCTGTCCGTTCAAATTTGCCGGCCTGGCAGGTAGCCGAGAAATTTACCGAAATGGCCATGGCCGGTA
CCCCGGATGATGTGGGCCAGATTACCAGTGTGGCAATGGAAGGCATTGGTCTTATCCCGCTTACCCGTGT
TCCTGCAGCACTGCCGGTGCGCCTGGAAAATCAGTACTTCGTGCTGGATATGGAGAGCCGTGCGGCGCAG
GAGATGCTGGAGCAGGGCGTGTGCTTGTTCTACGTACCGTCACTGTTGGGCGAGCTTGAACTTGAACTGT
TTGCGGTGCTGCGCTCATGA