SecReT6
Protein ID: 512650066
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11255
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2210711..2212252 [-]
ProductEvpB/family type VI secretion protein
NoteTssC
UniProt IDR9VLP1
KEGG IDenr:H650_11255
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.50E-173, Aligned region: 87..509
Protein Sequence: 513 a.a.     [Download]
>gi|512650066|ref|YP_008108066.1| EvpB/family type VI secretion protein [Enterobacter sp. R4-368]
MSVQNESVATGESVVLQGTQAGGVYASLFEKINLNPVTTLSALDIWQDAQAMSDATADERLTAGMQVFLE
CLTKSGSKVEKLDRNLIDHHIAQLDYQISRQLDAVMHHEAFQAVESLWCGLKSLVDKTDFRQNVKIELLD
LSKDDLRQDFEDSPEIIQSGLYKHTYIDEYDTPGGEPIAALISAYEFDASAQDVALLRNISKVSAAAHMP
FIGSAGPKFFLKDAMADVAAIKDIGNYFDRAEYIKWKSFRETDDSRYIGLVMPRVLGRLPYGPDTVPVRS
FNYVEQVKGPDHDKYLWTNASFAFAANMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIDDNPGFFRVKLYAI
PHFQVEGMDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2212252-2210711 Enterobacter sp. R4-368, complete genome
ATGTCTGTACAAAATGAAAGTGTCGCCACAGGCGAAAGCGTGGTTTTACAAGGCACGCAAGCGGGAGGTG
TCTATGCCTCTTTATTTGAAAAAATCAATCTGAACCCGGTAACAACGCTAAGCGCGCTGGATATCTGGCA
GGATGCGCAGGCGATGTCGGATGCAACAGCCGATGAGCGTCTGACCGCAGGGATGCAGGTGTTCCTGGAA
TGCCTGACAAAATCCGGTTCGAAAGTTGAAAAACTTGACCGCAATTTGATTGATCACCATATCGCACAGC
TGGATTACCAGATTAGCCGTCAACTGGATGCGGTGATGCACCATGAGGCGTTTCAGGCAGTAGAAAGTCT
GTGGTGTGGGCTGAAATCTCTGGTGGATAAAACCGATTTTCGCCAGAACGTCAAAATCGAACTGCTCGAT
CTCTCCAAAGACGATCTGCGCCAGGATTTTGAAGATAGCCCCGAAATTATTCAGAGTGGTTTATACAAAC
ACACTTATATCGATGAATATGACACGCCGGGTGGCGAGCCCATTGCCGCGCTGATTTCTGCTTACGAGTT
TGATGCTTCTGCGCAGGATGTCGCTTTGCTGCGCAATATTTCGAAAGTGTCTGCCGCTGCCCACATGCCG
TTTATCGGCTCTGCGGGGCCGAAATTTTTCCTCAAGGACGCGATGGCGGACGTGGCGGCGATAAAAGATA
TCGGCAACTACTTTGACCGCGCTGAGTACATCAAGTGGAAATCCTTTCGCGAGACGGACGACTCCCGCTA
TATCGGTCTGGTGATGCCGCGTGTGCTTGGCCGCCTGCCATATGGCCCTGACACCGTGCCGGTACGCAGT
TTCAATTATGTGGAACAAGTGAAAGGGCCGGATCACGATAAATACCTGTGGACCAACGCCTCGTTCGCCT
TTGCCGCCAATATGGTACGCAGCTTTATCAATAACGGTTGGTGTGTACAAATTCGTGGCCCGCAGGCGGG
CGGTGCAGTTCAGGATCTGCCTATTCACCTTTACGACCTCGGCACGGGCAATCAGGTAAAAATCCCCTCT
GAAGTGATGATCCCGGAAACGCGTGAGTTCGAGTTCGCAAATCTCGGCTTTATTCCACTGTCGTATTACA
AAAACCGTGATTACGCCTGCTTCTTCTCCGCTAACTCCACGCAGAAACCGGCGCTGTACGATACCGCTGA
CGCAACCGCCAATAGCCGTATCAATGCGCGCCTGCCGTATATCTTCCTGCTCTCGCGTATTGCGCATTAT
CTGAAGCTTATTCAGCGTGAAAACATCGGTACGACCAAAGATCGCCGTTTACTGGAACTGGAGCTGAACA
CCTGGGTGCGCAGTCTGGTCACCGAAATGACCGATCCGGGCGACGAGCTGCAGGCTTCCCATCCGCTGCG
TGATGCCAAAGTCGTGGTGGAAGATATTGACGATAACCCGGGGTTCTTCCGCGTCAAACTCTATGCCATC
CCGCATTTCCAGGTCGAAGGCATGGACGTCAACCTGTCACTGGTTTCCCAGATGCCGAAGGCCAAGTCAT
AA