SecReT6
Protein ID: 512650067
SecReT6 ID810
T6SS typei2
Gene symbol-
Locus tagH650_11260
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2212291..2212788 [-]
Producthypothetical protein
NoteTssB
UniProt IDR9VQB4
KEGG IDenr:H650_11260
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.30E-51, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|512650067|ref|YP_008108067.1| hypothetical protein H650_11260 [Enterobacter sp. R4-368]
MSDSFQREIPKARINLKLDLHTGGAQKKTELPLKLLVTGDFSNGQETASLSERVKVNVNKNNFNSVLSDY
SPKVNLVVENTLAGNGSEENISLTFRDMKDFTPEEVARQIPQLKAMLAMRNLLRDLKANLLDNQTFRKEL
EKILLNPSLSAELRDELSSLAPKQP
 
Nucleotide Sequence: 498 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2212788-2212291 Enterobacter sp. R4-368, complete genome
ATGAGCGATAGCTTCCAGCGGGAGATACCGAAAGCACGTATCAACCTGAAACTCGACCTGCATACGGGCG
GAGCACAGAAAAAAACAGAATTACCGTTGAAATTACTGGTGACGGGTGATTTTAGTAATGGGCAGGAAAC
GGCGTCTTTAAGCGAACGCGTTAAAGTCAACGTTAATAAAAATAACTTTAATAGTGTTCTTTCTGATTAT
TCCCCAAAAGTTAACCTTGTTGTTGAAAATACCCTGGCGGGTAATGGTAGCGAAGAGAATATCAGCTTGA
CGTTCCGCGATATGAAAGATTTCACGCCAGAAGAGGTTGCCCGCCAAATTCCCCAGCTCAAAGCTATGTT
GGCAATGCGCAATCTGCTTCGCGATCTGAAAGCGAACTTACTCGATAATCAGACTTTCCGAAAGGAATTA
GAAAAAATTCTTCTTAACCCCTCTCTCAGCGCAGAACTGCGTGATGAGCTCTCCTCTCTTGCGCCCAAAC
AGCCATAA