SecReT6
Protein ID: 512685499
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24420
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2779356..2780441 [-]
Productputative type VI secretion system protein
NoteTssA
UniProt IDT2H5T3
KEGG IDppun:PP4_24420
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 241..258
Protein Sequence: 361 a.a.     [Download]
>gi|512685499|ref|YP_008113479.1| putative type VI secretion system protein [Pseudomonas putida NBRC 14164]
MPEILNDLSLATLAAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTANWEQVIDLSAQGL
AEQSKDLMLAAWLSEGLAQREHFKGITFGLELTERVLDAFWETLYPTLEDGLDERAARLSWLKTTLSDIA
GGLPITQGQNFGVLRYDESRHVENLALQNPKAMQTALNEGKINAEIFQRSVALSDTDHLRAKALEIATSL
NACKRLQATVDRLFEREAPSFASLADMLSRASQLAEKLLKDRGVELHPTLLEEQEPEAVTANPQSAGEQM
DTRPPATVPAAMRTTPLTRDEAFTMLAGIAQYFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDNNV
VDNIRDVLGTR
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2780441-2779356 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGCCTGAAATTCTCAATGACCTTTCGCTGGCCACGCTGGCCGCCCCCATCGAGGGTGGCAGTGGCGAAG
ACTTGAGCTTCTCTGCCTTGTTCGACCAGATCAAGGAGGCACGCCGGGCCGACCCTGACTACCTGACCCA
GGGCGACTGGCAAACCGACCTGAAGACTGCCAACTGGGAGCAGGTGATCGACCTGTCGGCGCAAGGGCTG
GCGGAGCAGAGCAAAGATTTGATGCTGGCGGCCTGGCTCAGTGAAGGGCTGGCTCAGCGCGAGCACTTCA
AAGGTATCACCTTTGGCCTGGAGCTGACCGAACGGGTGCTGGACGCGTTTTGGGAGACGCTGTACCCAAC
CCTGGAAGACGGCCTGGATGAGCGCGCAGCGCGGCTGTCCTGGCTCAAGACCACGCTCAGCGACATTGCC
GGTGGTTTGCCCATTACCCAAGGGCAGAATTTTGGCGTGTTGCGCTATGACGAATCACGCCACGTAGAAA
ACCTCGCCTTGCAAAACCCCAAGGCAATGCAGACAGCGCTTAACGAAGGCAAGATCAACGCTGAGATTTT
CCAGCGCTCGGTAGCACTTAGCGACACCGATCACCTGCGCGCCAAGGCCTTGGAGATTGCCACCAGTCTC
AATGCATGCAAGCGCCTGCAGGCTACGGTAGACCGCCTGTTCGAGCGCGAGGCACCCAGCTTTGCCAGCC
TTGCCGACATGCTCTCGCGTGCAAGCCAGCTGGCGGAGAAACTGCTCAAGGACCGCGGTGTCGAGCTGCA
CCCCACCCTCCTCGAGGAGCAGGAGCCAGAGGCCGTCACGGCCAACCCCCAATCAGCAGGTGAACAAATG
GATACACGCCCACCGGCGACTGTGCCAGCCGCCATGCGCACCACGCCGCTGACCCGCGATGAGGCGTTCA
CCATGCTTGCGGGCATTGCCCAGTACTTCAAGCAGAGCGAACCGCAAAGCCCGGTACCCTACCTGATAGA
ACGTGCAATAAAGTGGGGCAACATGCCGCTGGAAGGCTGGCTCAGTGATGTGATCAAAGACAACAATGTC
GTGGACAACATCCGTGATGTGCTGGGCACCCGCTAG