SecReT6
Protein ID: 512685500
SecReT6 ID811
T6SS typei4b
Gene symbolhcp
Locus tagPP4_24430
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2780538..2781056 [-]
Productputative type VI secretion system effector Hcp
NoteTssD
UniProt IDT2H8B9
KEGG IDppun:PP4_24430
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.60E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|512685500|ref|YP_008113480.1| putative type VI secretion system effector Hcp [Pseudomonas putida NBRC 14164]
MAFDAYIQIDGIPGEVLDDKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFVAGGNQGGEDKAVSDLPIEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2781056-2780538 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCGGGCGAAGTACTGGATGACAAACACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACCCAGGCTACCTCGGCAACTGCCAGCTCCTCGGGTGG
TGCGTCGTCCGAGCGTGTTGCCCTGAGCGACTTCAAGATCCGTAAAGCCGTCGACAAGGCTTCGGCCAAG
CTGTTCGAGCACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAACTGAACGTGAACCGTGCAGGTGGCG
ATAAAGTCACCTACCTGACCATCGACATGGAAGAAGTCGTGGTCTCGTCGGTGAAGTTCGTTGCCGGTGG
CAACCAAGGGGGTGAAGACAAGGCCGTCAGCGACCTGCCAATTGAAGAAATCAGCTTCAACTTTGCCCGT
ATCAAGACCACCTACACCCAGCAGAACCGCACCGACGGTCAGGCCGGCGGCAACATCGTCGGTGGCTGGG
ACCGCACCGCGAACAAAGTGTTTGCCTAA