SecReT6
Protein ID: 512685501
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24440
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2781200..2783695 [-]
Productputative type VI secretion system protein
NoteTssM
UniProt IDT2H704
KEGG IDppun:PP4_24440
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.70E-68, Aligned region: 83..112
ImcF-related_N [PF14331], Evalue: 8.70E-68, Aligned region: 189..453
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 716..811
IcmF-related [PF06761], Evalue: 3.90E-09, Aligned region: 94..130
IcmF-related [PF06761], Evalue: 3.90E-09, Aligned region: 505..641
Protein Sequence: 831 a.a.     [Download]
>gi|512685501|ref|YP_008113481.1| putative type VI secretion system protein [Pseudomonas putida NBRC 14164]
MNKIKYYCLRYQPYLLGVAFFLAIFLVWAIGRAFGFASLHSLLAGIGVFLLLSAGYVLLLYRGVGQHHNL
EGLLRDDADQAVLSATPADREEVSLLRERLLQSIERLHSNKPRGASAKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIDDILHGSAEDQERVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTAFYRQLDDASRG
EVMGKTFSHKGYEQADWGQRFGKAMDELTGYWRQVAGQQLVQQDIQVTRQNNAAYRFPLELAALKPRLQQ
FVDSLLRANPYQSAEMLRGFYFTAALQADEAQWGSHGQHVAERFALEHAAGAAEAGSQPAPLFINSLFRK
VIIPDQHLVALYTSNHRERRRKAGWVGAAGLVAIVLCSLWGWSYLNNRATLASIAGELAQAKADDQAASG
QYTAWRSLDRLRFWAAHYYQQHHEQGVPLGMRLGLYQGHEVEPLLRSRYFATLQNVMLKPTADNLTRTLY
LLTTLKVYQRNTRELQPVSGVDSVEAEALPHDNRAQSIADFGKATLDTYVMLSPAQREKADPAFLKAHLP
DYWYPAIARHTGQRMTAAGSEAGSNQDYLYASRQITFYSDQIREPDAPRILDNAFLMSSSRNYIDSLRAQ
SLRSIETITLESDTLFAFGRADFQSLRNEGQGQLSAIASKLLNTPNIGKIVISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDMQQPRAQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2783695-2781200 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGAACAAGATCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGAGTGGCGTTCTTCCTGGCGA
TTTTCCTGGTCTGGGCCATTGGCCGTGCCTTCGGCTTCGCCTCGCTGCACAGCTTGCTCGCAGGTATCGG
CGTGTTTCTGTTGCTGTCAGCGGGCTATGTACTGCTGCTGTACCGCGGTGTCGGCCAACACCACAACCTC
GAAGGCTTGCTGCGTGACGACGCTGACCAGGCCGTACTCAGCGCCACCCCGGCCGACCGCGAAGAAGTCA
GCCTGTTGCGCGAGCGCCTGCTGCAGAGCATCGAGCGCCTGCACAGCAACAAGCCCCGCGGCGCCTCGGC
CAAAGACGCGCTGTATGCCCTGCCCTGGTACCTGGTGATAGGCCAGCCGGCCGCGGGCAAGAGCACCATG
ATCCTGCAGTCGGGCCTGAACTTCCCCTATGCCGAGCGCGAAGGCGCAAGGGTGGCGGGCCTGGGCGGCA
CGCGCAACTGCGACTGGTTTTTCAGTTCCGAAGCGGTGCTGCTGGACACCGCCGGGCGCTACATGAACAG
CCCGGAAGAAGCCGGCAAATGGCGCGGCTTCCTGCAGCTGCTGCGCCAGCATCGCCAGCGCCGTCCCCTC
AACGGGTTGATCGTGAGCGTCAGCATCGACGACATCCTGCATGGCTCGGCCGAGGACCAGGAGCGCGTGG
CCAAGCGCCTGCGCGAACGCATTCAGGAAAGCTGCGCCCTGCTCGAAGTGCGCCTGCCCATCTACCTGGT
GTTCACCAAGTGCGACCTGATACCCGGGTTTACAGCGTTCTATCGCCAGCTGGACGACGCCTCACGTGGC
GAAGTGATGGGCAAAACCTTCTCGCACAAGGGTTACGAACAGGCCGACTGGGGCCAGCGCTTCGGCAAGG
CCATGGACGAGCTGACCGGTTACTGGCGGCAGGTGGCAGGCCAGCAGTTGGTGCAACAGGACATTCAGGT
AACTCGGCAGAACAACGCTGCCTATCGGTTCCCGCTGGAGCTCGCCGCCCTCAAGCCGCGCTTGCAGCAG
TTCGTCGACAGCCTGTTGCGTGCCAACCCGTACCAGAGTGCCGAAATGCTGCGCGGTTTCTATTTCACCG
CCGCGCTGCAAGCCGACGAAGCCCAGTGGGGCAGCCACGGCCAGCATGTGGCCGAGCGCTTCGCACTCGA
ACACGCCGCAGGTGCTGCCGAAGCTGGCAGCCAGCCGGCGCCGCTATTCATCAATAGCCTGTTCCGCAAG
GTCATCATCCCCGACCAACACCTGGTGGCGCTGTACACCAGCAACCACCGCGAACGCCGGCGCAAGGCTG
GCTGGGTCGGCGCCGCCGGCCTGGTAGCCATTGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCACCCTGGCCAGCATTGCCGGCGAACTGGCCCAGGCCAAGGCCGACGACCAGGCTGCCAGCGGC
CAGTACACCGCCTGGCGTAGCCTGGATCGCTTGCGCTTCTGGGCCGCGCACTACTATCAGCAACACCATG
AGCAGGGCGTGCCGCTCGGCATGCGCCTGGGCCTTTACCAGGGCCATGAAGTCGAGCCGCTGCTGCGCAG
CCGCTACTTCGCCACGTTGCAGAACGTGATGCTCAAACCCACGGCCGACAACCTCACGCGAACCCTTTAC
CTGTTGACCACGCTCAAGGTCTACCAGCGCAACACCCGCGAGTTGCAGCCGGTGAGCGGTGTTGACAGCG
TCGAGGCCGAGGCGCTGCCGCATGACAACCGCGCCCAGTCGATCGCCGATTTCGGCAAGGCCACCCTGGA
CACCTATGTGATGCTGTCCCCGGCCCAGCGCGAAAAGGCCGACCCGGCGTTCCTCAAGGCGCACCTGCCG
GACTACTGGTACCCGGCTATCGCCCGCCACACCGGCCAGCGCATGACCGCAGCCGGTAGCGAAGCAGGCA
GCAACCAGGACTACCTGTACGCAAGCCGGCAGATCACTTTCTATAGCGACCAGATCCGTGAGCCGGATGC
GCCACGCATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGTAACTACATCGACAGCCTGCGGGCTCAG
TCGCTGCGCTCGATCGAGACCATCACGCTGGAATCCGACACCCTGTTCGCTTTCGGCCGCGCCGACTTCC
AGAGCCTTAGAAACGAAGGCCAGGGCCAGCTTAGCGCGATTGCCAGCAAGCTGCTGAACACCCCGAACAT
CGGCAAGATCGTCATCTCGGGCCACGCCGACCAGTTGGGCGACAGCCAGGGCAACCTGCAGGTTTCGAAA
CAACGGGCGCAAACCATACGCACCTATCTGGTCGGCAAGGGCGTGCCTGCCGAACTGGTGGTTGCACAAG
GCGAAGGGAGCCGCAAGCCATTGGTCAATTGCGACATGCAGCAACCGCGCGCGCAATTGATCAAGTGTCT
TGAGCCCAACCGCCGGGTAGAAATCGAAGTGCGTGGTCTCAACTGA

Protein ID: 512685503
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24460
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2784597..2788394 [-]
Productputative type VI secretion system protein
NoteTssM
UniProt IDT2H5R3
KEGG IDppun:PP4_24460
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.30E-61, Aligned region: 181..434
IcmF-related [PF06761], Evalue: 8.00E-44, Aligned region: 491..555
IcmF-related [PF06761], Evalue: 8.00E-44, Aligned region: 625..876
DUF1215 [PF06744], Evalue: 5.10E-23, Aligned region: 1009..1124
AAA_16 [PF13191], Evalue: 8.70E-05, Aligned region: 112..263
AAA_16 [PF13191], Evalue: 8.70E-05, Aligned region: 368..402
AAA_16 [PF13191], Evalue: 8.70E-05, Aligned region: 462..503
AAA_16 [PF13191], Evalue: 8.70E-05, Aligned region: 845..898
Protein Sequence: 1265 a.a.     [Download]
>gi|512685503|ref|YP_008113483.1| putative type VI secretion system protein [Pseudomonas putida NBRC 14164]
MKTLLRLLKSFWVLLPLLWLASLLICWLAAPLVPWLRHHVPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVV
SLPELLAANSDERNALANQLVARVEEYAECLGANPPIYLMLSKTDQLPGFSQAFEGLDLHERQQPLGMTF
GLSEIRNNGLHAVLQTRLKNLQGRIRQHVDAQMIALGAEADSTLLNFPQYFAALSEVLEPFLDHFTQGHR
GGNPLLLRGLYFTSALQTGQQLGQVYEDVIADEFALQAAYDERVESTTKAVGNRSYFITDTFRRVIFPDR
DLTLYQSRQGSQAAFSPLLLGLAVATGVVFIGWQALSFINNRQWLEGLRGQLAQIEQAQEREQLLAAGKG
LEVLREQMSIVEAHRLQGVPLQLAAGLYHGEAIHQVSSTAYLAQLRSQALEPIARSLQVQMRAFNTFANG
INQALEFTPAPQPKKRSGKAIAAAVAAKAAAVDTRLGAYAAKVNLATASDAAELSATTGGLSLSEEMLGR
LNEQQVASIIEAYNTLKLYLLLTEPQAHPDPAFVSASLPQAWAGAAAEGSPADTRVIEENVPLYVQLLEQ
GQAPALPRNEQLINETRQNLKAFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYSSAGVPA
IYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDAVVQKANFVREFMARYKRDYTQAWYKMVSSVGM
RHFADLASATDQLGLLSDVQNSPVKNLLAAVNDNTRWDLPINHAIPSPGAARDDGFWSKVTGLFDADHAL
PANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKGSKQL
ISETLEGQPSEVTTVRNYVEGSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGQQIAKAWAQQIAKPWE
QVMAHRYPIAGSSNNEASVKDLQRFVDPQSGLLPAFKRNEIGNLAGGEGLGVGDSKGPALVNPGMLNSID
KASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPATSNAPGARLDVVT
LSGARLTVFDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGNVKALSALN
DRGAQ
 
Nucleotide Sequence: 3798 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2788394-2784597 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGAAAACATTACTGCGTCTGTTGAAAAGTTTCTGGGTGCTGCTGCCATTGCTGTGGCTGGCCAGCCTGT
TGATTTGCTGGCTGGCCGCGCCGCTGGTGCCGTGGCTGCGTCATCACGTGCCGGAAGCGCTGGCAATAAT
CAGTGCCTGCTTCCTGCTGGTGATTGTGCTGCGCCAATATCAGCGCATCCGTGCCGAGCACAACCTCGAG
AACCTGCTGCAAATCGAGGTCGACCGCTCGTGGAATGCCACCGGCGAGTTCCGTGACCAGCAGGTACTGC
GCGAGCGCCTGAAGCACGCCATCGCCATGCTGCGCACCGACCGCTCTGCCGGAGGCGGCGGCAAGGCCGC
GCTGTCCGATCTGCCCTGGTACCTGGTGGTTGGCATGTCGGCTGCGGGCAAGACTTCGCTGCTGACCCAT
TCCGGCTTGTCGGCCAGCATTGCCACGGCCAACGACAGTGAAAGCGGTACCCAGCACTGCGACTGGTACT
TCAGCCCCGATGCCGTGATGATCGATACCGCCGGGCGCTACCTGCGCGACGACCAGTCGGCCAGCGAGTT
CTCGGCCTTTCTGCGGATGCTGCGCAAGCAGCGCGGCAAGGCGGCGATCAATGGCCTGGTCCTGGTGGTA
AGCCTGCCCGAGTTACTGGCGGCCAACAGCGATGAGCGCAATGCCTTGGCCAACCAGTTGGTGGCACGGG
TCGAAGAGTACGCCGAATGCCTGGGCGCCAACCCGCCGATCTACCTGATGCTGAGCAAGACCGACCAGTT
GCCGGGGTTCAGCCAGGCATTTGAGGGCCTCGACCTGCACGAACGCCAGCAGCCGCTGGGCATGACCTTT
GGCCTGTCGGAAATCCGCAACAATGGCCTGCACGCCGTGCTGCAAACGCGGCTGAAAAACCTGCAAGGCC
GTATTCGCCAGCACGTCGACGCACAGATGATCGCCCTCGGTGCCGAAGCCGATAGCACCCTGTTGAACTT
CCCGCAGTATTTCGCCGCCCTCAGTGAAGTGCTCGAACCCTTCCTTGACCACTTCACCCAGGGCCATCGC
GGTGGTAATCCGCTATTGCTGCGGGGCCTGTACTTCACCAGTGCGCTGCAGACCGGGCAGCAGCTGGGGC
AGGTTTATGAAGACGTCATCGCCGATGAGTTCGCCCTCCAGGCGGCCTACGACGAGCGCGTCGAAAGCAC
CACCAAGGCCGTCGGTAACCGCAGCTACTTCATCACCGACACCTTCCGCCGGGTGATCTTCCCGGACCGC
GACCTGACTTTGTACCAGTCGCGCCAGGGCAGCCAGGCCGCGTTCAGCCCTCTGTTACTAGGCCTGGCCG
TCGCCACGGGGGTTGTGTTCATCGGCTGGCAGGCACTGTCGTTCATCAACAACCGGCAATGGCTCGAAGG
CCTGCGCGGGCAACTGGCGCAGATCGAACAAGCGCAGGAGCGCGAGCAACTGCTGGCTGCCGGCAAGGGG
TTGGAGGTGCTGCGCGAACAGATGTCGATCGTCGAAGCCCATCGCCTGCAAGGTGTCCCGCTGCAATTGG
CTGCCGGCCTTTACCATGGCGAAGCGATCCACCAGGTGAGCAGCACCGCTTACCTGGCGCAATTGCGCAG
CCAGGCGCTGGAGCCGATCGCCCGTAGCCTGCAAGTGCAGATGCGCGCGTTCAACACCTTTGCCAACGGC
ATCAACCAGGCCCTGGAGTTCACCCCGGCGCCGCAGCCTAAAAAACGCAGCGGCAAGGCGATCGCCGCTG
CCGTGGCCGCCAAGGCCGCCGCAGTCGACACCCGCCTGGGCGCCTACGCCGCCAAGGTCAACCTGGCCAC
GGCCAGCGATGCTGCCGAGTTGTCTGCCACTACCGGCGGCCTGTCGTTGTCCGAAGAAATGCTTGGCCGG
CTGAACGAACAACAGGTGGCCTCGATCATCGAGGCCTACAACACACTCAAACTGTACCTGCTGCTGACCG
AACCCCAGGCTCACCCGGACCCGGCCTTCGTCTCTGCAAGCCTGCCCCAGGCCTGGGCCGGCGCAGCAGC
TGAAGGGTCCCCGGCCGACACCCGGGTAATCGAGGAAAACGTGCCGCTGTACGTGCAGCTGCTGGAGCAA
GGCCAAGCGCCCGCGCTGCCGCGCAACGAGCAGTTGATCAATGAAACCCGGCAGAACCTCAAGGCATTCA
TGATCTCCAGCTCCCTGGTCGATCGCGAATACCTGCGCCTGCAACTTGAGTCGAGCCGCCAGTTCCCGGC
GCTCAGCCTCAACGACCTGGTCCCGCAACCGGGCCGCGCGCTGCTGTACAGCTCCGCTGGGGTACCGGCA
ATCTACACGCGCCAGGGCTGGGACACCTTCGTCAAGCCCGAGCTGATCAAGCTGGTGTCGGGCAACCTGC
GCAACGAGTCGGACTGGGTGCTGGACGGCGAAGGCGGCGATGCCGTCGTGCAAAAAGCCAACTTCGTGCG
TGAGTTCATGGCCCGCTACAAGCGCGACTACACCCAAGCCTGGTACAAGATGGTCAGCAGCGTCGGCATG
CGCCACTTCGCCGACCTGGCCTCGGCCACCGATCAACTGGGCCTGCTCAGCGACGTGCAGAACTCGCCGG
TGAAGAACCTGCTGGCTGCGGTCAATGACAATACCCGCTGGGACCTGCCGATCAACCATGCTATCCCGAG
CCCAGGTGCCGCCCGCGATGACGGCTTCTGGAGCAAGGTCACCGGCCTGTTCGATGCCGATCACGCCCTG
CCCGCCAACGTCGCCCCGGCCCTGCCGGCAGTGGATGACGGCAGCCTGGCCAAGCGTTTCGAACCGGTGG
CGCGGGTGTTCGCCGAGAACAACGCAGAAGGCGCCGACAGCACCATCATGGACCGCTACCTGGCTGCGCT
GCGCAAGCTCAAGGTGCGCATGAACAACATCCAGCGCTCGCAGGATGTGGGAAAGGGCAGCAAGCAGTTG
ATCAGCGAGACCCTGGAAGGCCAGCCGAGCGAAGTCACCACCGTACGCAATTATGTGGAAGGCAGCGTCG
ATACCAGCCAGGACGGCCTGTCCCGCTCCTTGCAGGGGCTGTTCAGCCTGCCCATCCAGTACGCCTGGGC
CACCCTGCGCGACCCGGCCGGCCAGCAAATCGCCAAAGCCTGGGCACAGCAGATCGCCAAACCGTGGGAA
CAGGTCATGGCGCACCGTTACCCCATTGCCGGTAGCAGCAACAACGAAGCGTCGGTGAAAGACCTGCAGC
GCTTCGTCGACCCGCAAAGCGGCCTGCTCCCGGCGTTCAAGCGTAACGAAATCGGCAACCTGGCCGGCGG
TGAAGGCCTGGGCGTGGGTGACAGCAAGGGGCCAGCGCTGGTCAACCCCGGCATGCTCAACAGCATCGAC
AAGGCCAGCTCGGTGGGCCAGGTGATCGCCAGCCTCTCGGACCGTGACAACGGCTTTGAGATCATGCTGG
AGCCTTCGGCCAACTTCACCGACATCGTGTTCACGCTCGATGGCCAGGAACAGCACTACCGTAACGGCCG
CAGCAGCTGGAACCGCTTTGCCTGGCCGGCCACCAGCAACGCCCCCGGCGCACGCCTGGACGTGGTTACC
CTGAGCGGCGCACGGCTTACCGTGTTCGACTTCCCGGGCCGATGGGGCCTTCTGCGCATGAACGAAAGCG
CCCGCGTCGACGACCTGGACGGCATTCAGCAACGCTTTAGCTGGAACACCGCCAGTGGCCGCGTGAGCCT
TGTTGTACGCAACTTCGGTGGGGTCAAGCTGACCGATCTGGGTAACGTCAAGGCCCTGAGCGCCCTCAAC
GACAGGGGCGCGCAATGA