SecReT6
Protein ID: 512685504
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24470
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2788425..2789141 [-]
Productputative type VI secretion system protein
NoteTssL
UniProt IDT2H5T8
KEGG IDppun:PP4_24470
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-53, Aligned region: 19..221
Protein Sequence: 238 a.a.     [Download]
>gi|512685504|ref|YP_008113484.1| putative type VI secretion system protein [Pseudomonas putida NBRC 14164]
MTEAVLQQGAVAAANDKPTLKDLVQDFISMALIVRRGRQVTSVQAFEGSVERFFTNLERDARAANYSVEQ
VKDTQYALCAFLDESVLRSGDNELRRHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHL
CLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLTLIALVC
IAVYLTLDWLLDKDVAALSEQIRQLFSA
 
Nucleotide Sequence: 717 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2789141-2788425 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGACCGAAGCCGTATTGCAACAGGGCGCCGTCGCGGCCGCCAATGACAAACCGACACTCAAGGACCTGG
TCCAGGACTTCATCAGCATGGCGCTGATCGTGCGTCGCGGGCGCCAGGTCACCTCGGTGCAGGCTTTCGA
AGGCAGCGTCGAGCGCTTTTTCACCAACCTGGAGCGTGATGCCCGCGCCGCCAACTACAGCGTCGAGCAG
GTCAAGGACACCCAATACGCGCTGTGCGCTTTCCTCGACGAAAGCGTACTGCGCTCAGGCGACAACGAAC
TGCGCCGGCACTTTGAACTGCAGCCGTTGCAGTTCCGCTATTTCGGCGTGCACCTGGCAGGTGAAGGCTT
CTTCGAAAAAGTGGATGCGCTACGTGCCGACGTCAAGCAGAACATCGACGTGCTCGAGGTCTACCACCTG
TGCCTGGCCCTGGGCTTCGAGGGCAAGTTCAGCCTCGGCCAGAAAGACCAGCTGCGCTACCTGGCCAATA
CCTTGGGCCAGGATATCGCCCGCTACCGCAAGGCGCCCAAAGCCCTGTCACCGGACTGGGCCCTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCATGAAGTGCCGCTGTGGGTGTATCTGACGCTGATCGCGCTGGTCTGC
ATCGCCGTGTACCTCACGCTCGACTGGTTGCTGGACAAGGACGTCGCCGCCCTGTCCGAACAAATCCGCC
AGCTGTTCAGTGCCTGA