SecReT6
Protein ID: 512685505
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24480
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2789138..2790481 [-]
Producthypothetical protein
NoteTssK
UniProt IDT2H8C6
KEGG IDppun:PP4_24480
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-135, Aligned region: 19..445
Protein Sequence: 447 a.a.     [Download]
>gi|512685505|ref|YP_008113485.1| hypothetical protein PP4_24480 [Pseudomonas putida NBRC 14164]
MSKQSRVMWSEGMFLLPQHFQYQDEFHQHQLAESTLRSTPFHWGVQALQVDEDALANGTLQLKRLKLVFP
DGSLYDAPQHDPLPAARDLKDLLKANDLKVYAALKLPEPFGLNYVEDGHEHKAARRFRKQFDTLPDLNEG
ELENEITSLRLNVVMLVDGDSLDGYTHCPLAKLTRNSMGGFNIDPHFVHPTLHLGSHETIAGLGKRLLGA
LQAKSKALSGRRRERADQIAEFGSSDVTLFWLLNTVNRAHPQLAHLLAHPRLHPERLYLFLADLAGGLLT
FTLDTQLSDIPEYDHQDPAASLVKLDEMIRVMLDNVVPNQCIVINLTQTKPSHWQGQLHDPRLAEADFYI
AVHADMPGASLLELVPRAFKVGSPEDIEVVVNSAMPGVTLNHAARLPNAIPVRLDNQYFAIEPHGNVYER
MINAQAICFYAPSAFTNLKLELMAVLK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2790481-2789138 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGAGCAAGCAGAGCCGGGTGATGTGGTCGGAAGGCATGTTCCTGCTGCCCCAGCACTTCCAGTACCAGG
ACGAGTTCCACCAGCACCAGTTGGCTGAGTCGACACTGCGCAGTACCCCTTTCCATTGGGGGGTACAAGC
GCTGCAGGTCGACGAAGACGCCCTGGCCAACGGTACGCTGCAGCTCAAACGCCTGAAGCTTGTGTTCCCA
GATGGCAGCCTGTACGACGCGCCGCAGCACGACCCGCTGCCTGCCGCACGCGACCTCAAAGACCTGCTCA
AGGCCAATGACCTCAAGGTCTATGCGGCACTCAAGCTGCCTGAGCCCTTTGGCCTCAATTACGTCGAAGA
TGGCCACGAACACAAGGCTGCGCGGCGTTTTCGCAAACAGTTCGACACCCTGCCAGACCTTAACGAAGGC
GAACTGGAGAACGAAATCACCAGCCTGCGCCTGAACGTGGTAATGCTGGTCGACGGTGACAGCCTCGACG
GTTACACCCATTGTCCATTGGCCAAGCTGACCCGCAACAGCATGGGCGGCTTCAATATTGACCCGCATTT
CGTCCACCCTACCCTGCACCTGGGTAGCCACGAAACCATCGCCGGGCTCGGCAAGCGCCTGCTCGGGGCC
CTGCAGGCCAAGAGCAAGGCACTTTCCGGCCGGCGACGTGAGCGCGCCGACCAGATCGCCGAGTTCGGGT
CCAGCGACGTCACGCTGTTCTGGTTGTTGAACACGGTCAACCGTGCCCACCCGCAGTTGGCTCATCTGCT
GGCTCATCCGCGCCTGCACCCGGAGCGCTTGTACCTGTTCCTCGCCGACCTGGCTGGCGGGCTGCTGACC
TTCACCCTGGACACCCAGTTAAGCGACATCCCTGAGTACGACCATCAAGACCCCGCAGCATCATTGGTGA
AACTGGACGAGATGATCCGGGTAATGCTCGACAACGTCGTGCCCAACCAGTGCATCGTCATCAACCTTAC
CCAGACCAAACCGTCGCATTGGCAAGGCCAGTTGCACGATCCACGCCTGGCCGAGGCGGACTTCTATATT
GCCGTGCACGCCGACATGCCCGGCGCCAGCCTGTTGGAGCTGGTGCCCCGGGCGTTCAAGGTCGGCTCAC
CGGAAGACATCGAAGTGGTGGTCAACAGCGCCATGCCTGGTGTCACCCTCAACCATGCCGCCCGGCTGCC
GAACGCGATTCCGGTACGCCTGGACAACCAGTACTTCGCCATCGAGCCGCACGGCAATGTGTATGAGCGA
ATGATCAATGCCCAGGCCATCTGCTTCTATGCGCCCAGCGCCTTTACCAACCTCAAGCTTGAACTGATGG
CGGTGCTCAAATGA