SecReT6
Protein ID: 512685506
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24490
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2790478..2791200 [-]
Productputative type VI secretion system protein
NoteTssJ
UniProt IDT2H709
KEGG IDppun:PP4_24490
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-35, Aligned region: 17..172
Protein Sequence: 240 a.a.     [Download]
>gi|512685506|ref|YP_008113486.1| putative type VI secretion system protein [Pseudomonas putida NBRC 14164]
MQLKHTALKRLTTAALLLALAGCGVTDRIGKRMEDSWAADMLADNEKVILTSDGGNQLNPDAEGKPLSVV
MRVYQLTDLERFAATDAETLWDTPQKALGNTLVEAREITLLPGIGQIDQWPLAKNARYVGVAAFFRDEQG
ARWKVAFDANSLRKDGIWFSSDGLRVLVDKTEISAMRGVDVLDKPPTADQLAAAQKAKDADPTLTDKVQG
AVIEKASDAAGQSASNAMDSTFNSLVDSVK
 
Nucleotide Sequence: 723 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2791200-2790478 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGCAACTCAAGCACACCGCCCTCAAACGCCTGACCACCGCGGCCCTGCTGCTGGCGCTGGCCGGTTGTG
GGGTTACCGACCGAATCGGCAAACGCATGGAGGACAGCTGGGCTGCCGACATGCTGGCCGACAACGAGAA
GGTCATCCTGACCTCTGACGGCGGCAACCAGCTCAACCCTGATGCCGAGGGCAAGCCACTGTCGGTGGTG
ATGCGCGTGTACCAGCTGACGGACCTCGAGCGCTTCGCAGCGACCGATGCAGAGACCCTGTGGGATACCC
CGCAAAAGGCACTCGGCAACACCCTGGTGGAAGCACGCGAGATCACCCTGCTGCCGGGCATCGGCCAGAT
CGACCAATGGCCGCTGGCCAAGAATGCTCGCTACGTTGGTGTGGCGGCGTTCTTCCGCGATGAACAAGGC
GCGCGCTGGAAAGTCGCTTTCGACGCCAACTCGCTGCGCAAGGACGGCATCTGGTTCTCCTCCGACGGCC
TGCGGGTACTGGTGGACAAGACTGAAATCAGCGCCATGCGTGGCGTGGATGTGCTGGACAAACCACCCAC
CGCCGACCAGCTCGCGGCTGCGCAAAAGGCCAAAGACGCTGACCCGACCCTGACGGACAAGGTGCAGGGC
GCAGTTATCGAAAAAGCCTCCGACGCCGCAGGCCAGTCGGCCAGCAACGCCATGGATTCAACCTTCAACT
CTTTAGTGGATAGCGTCAAATGA