SecReT6
Protein ID: 512685507
SecReT6 ID811
T6SS typei4b
Gene symbolclpV
Locus tagPP4_24500
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2791225..2793822 [-]
Productputative type VI secretion system ATPase
NoteTssH
UniProt IDT2H7A5
KEGG IDppun:PP4_24500
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.40E-44, Aligned region: 34..46
AAA_2 [PF07724], Evalue: 8.40E-44, Aligned region: 225..243
AAA_2 [PF07724], Evalue: 8.40E-44, Aligned region: 596..763
AAA_2 [PF07724], Evalue: 8.40E-44, Aligned region: 817..837
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 59..79
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 225..338
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 602..720
ClpB_D2-small [PF10431], Evalue: 4.20E-14, Aligned region: 772..843
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 225..249
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 463..463
AAA_5 [PF07728], Evalue: 2.40E-13, Aligned region: 601..722
AAA_22 [PF13401], Evalue: 4.80E-10, Aligned region: 224..319
AAA_22 [PF13401], Evalue: 4.80E-10, Aligned region: 342..419
AAA_22 [PF13401], Evalue: 4.80E-10, Aligned region: 471..499
AAA_22 [PF13401], Evalue: 4.80E-10, Aligned region: 599..638
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 128..150
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 202..248
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 270..303
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 474..517
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 596..642
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 666..690
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 785..801
Sigma54_activat [PF00158], Evalue: 1.50E-07, Aligned region: 221..284
Sigma54_activat [PF00158], Evalue: 1.50E-07, Aligned region: 601..727
Clp_N [PF02861], Evalue: 1.20E-06, Aligned region: 21..73
Clp_N [PF02861], Evalue: 1.20E-06, Aligned region: 103..125
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 278..379
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 600..642
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 667..695
AAA_19 [PF13245], Evalue: 7.20E-06, Aligned region: 225..246
AAA_19 [PF13245], Evalue: 7.20E-06, Aligned region: 599..623
AAA_17 [PF13207], Evalue: 1.50E-05, Aligned region: 225..319
AAA_17 [PF13207], Evalue: 1.50E-05, Aligned region: 602..639
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 225..253
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 290..327
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 601..626
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 709..733
AAA_14 [PF13173], Evalue: 2.60E-05, Aligned region: 225..358
AAA_14 [PF13173], Evalue: 2.60E-05, Aligned region: 600..682
AAA_25 [PF13481], Evalue: 4.40E-05, Aligned region: 225..290
AAA_25 [PF13481], Evalue: 4.40E-05, Aligned region: 350..380
AAA_25 [PF13481], Evalue: 4.40E-05, Aligned region: 474..505
AAA_25 [PF13481], Evalue: 4.40E-05, Aligned region: 599..625
IstB_IS21 [PF01695], Evalue: 6.80E-05, Aligned region: 219..249
IstB_IS21 [PF01695], Evalue: 6.80E-05, Aligned region: 601..620
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 218..241
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 599..626
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 225..251
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 603..626
Zeta_toxin [PF06414], Evalue: 0.0012, Aligned region: 220..248
Zeta_toxin [PF06414], Evalue: 0.0012, Aligned region: 595..641
AAA_23 [PF13476], Evalue: 0.0022, Aligned region: 225..242
AAA_23 [PF13476], Evalue: 0.0022, Aligned region: 457..499
AAA_23 [PF13476], Evalue: 0.0022, Aligned region: 599..629
RNA_helicase [PF00910], Evalue: 0.0084, Aligned region: 226..246
RNA_helicase [PF00910], Evalue: 0.0084, Aligned region: 602..623
RNA_helicase [PF00910], Evalue: 0.0084, Aligned region: 702..720
Protein Sequence: 865 a.a.     [Download]
>gi|512685507|ref|YP_008113487.1| putative type VI secretion system ATPase [Pseudomonas putida NBRC 14164]
MNLKSLFAKLNETSRTATESAAALCLSEHHYDVEVEHLLLQLLDTGDNDLAPILRHYEVVAERLQAQLVT
ALGTFKKGNTRTPALSPHITRMIEQAWLLASIEYGVGQVRSGHLLQALLDDAELRRVVVASAPELEKINA
NDLRLNLAALVEGSAESRQASALASPAAPVANSSKAGGKTPALDQYTVNLTQSAREGRIDPVLGREFEVR
QMVDILTRRRQNNPILTGEAGVGKTAVVEGLALRIAQGDVPAVLKNVAVHTLDLGLLQAGAGVKGEFENR
LKAVIEEVKRSLHPIILFIDEAHTLIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LARRFQVVKVEEPDEDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSSRYITGRQLPDKAVSVLDTAC
ARIALAQSSQPGLLEDCRRQIDNLQAEIDVLGHEAGKGHDHARRLSELQASLQAKQQQEQQLNEQWQQEL
ALVEQLKALDAANDADAGQLNSLRAELARVQGDQPLVHALVDSGAIAQVISGWTGIPLGKMLRDEIDTVQ
RLPALLGERVLGQDHALHEIGKRIKISRARMEDPNKPIGVFLLLGPSGVGKTETALALADTLYGGERNLI
TINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLD
DGEGREINFRNTVIILTSNTGTERIMQTCLNATELPTPQAIVEGLRDELNHVFKPAFLGRLSIVPFYPVQ
DQILERIVALKLARIAKRFARNHQAELSYDEALVKAIAARCTEVDSGARNIDNILSQTLMPELAQRVLER
MAQDTPIERLVIELGSDGDFAYRLA
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2793822-2791225 Pseudomonas putida NBRC 14164 DNA, complete genome
GTGAACCTGAAGTCGCTGTTCGCCAAGCTCAACGAAACCAGCCGCACGGCCACCGAAAGCGCAGCGGCCC
TCTGCCTGTCAGAGCACCACTACGATGTCGAGGTGGAACACCTGCTGCTGCAGTTGCTCGACACCGGTGA
CAATGACCTGGCCCCGATCCTGCGCCACTATGAGGTGGTCGCCGAGCGCCTGCAGGCGCAGCTGGTCACC
GCCCTGGGCACGTTCAAGAAAGGCAATACCCGCACCCCGGCGCTGTCGCCGCACATTACCCGCATGATCG
AGCAGGCCTGGCTGCTGGCGTCCATCGAGTATGGCGTCGGCCAGGTGCGCAGCGGCCACTTGCTGCAAGC
CCTGCTCGACGACGCCGAACTGCGCCGGGTGGTCGTTGCCTCGGCGCCGGAGCTGGAAAAAATCAATGCC
AACGACCTGCGCCTGAACCTCGCCGCGCTCGTCGAAGGCAGCGCCGAGTCCCGCCAGGCAAGCGCCCTGG
CCAGCCCGGCGGCACCGGTGGCCAACAGCAGCAAGGCAGGCGGCAAGACCCCTGCGCTGGACCAGTACAC
CGTCAACCTCACCCAAAGTGCACGCGAAGGCCGCATCGACCCAGTGCTGGGCCGTGAGTTCGAAGTGCGG
CAGATGGTCGACATCCTCACCCGCCGCCGGCAGAACAACCCGATCCTCACCGGTGAAGCTGGCGTTGGCA
AAACCGCCGTGGTCGAAGGCCTGGCCCTGCGCATCGCCCAGGGCGACGTGCCAGCTGTGCTCAAGAACGT
TGCCGTGCATACCCTCGACCTTGGCCTGCTGCAAGCCGGCGCCGGGGTAAAGGGTGAGTTCGAAAACCGC
CTGAAGGCGGTCATCGAAGAGGTCAAACGCAGCCTGCACCCGATCATCCTGTTCATCGACGAAGCCCACA
CCCTGATCGGCTCTGGCGGCCAGGCCGGGCAGAACGACGCTGCCAACCTGCTCAAGCCGGCGTTGGCGCG
TGGCGAACTGCGTACCATCGCCGCCACCACCTGGGCCGAGTACAAGAAGTATTTCGAGAAGGACGCCGCC
CTCGCCCGCCGCTTCCAGGTGGTAAAGGTCGAAGAGCCTGACGAGGACAAGGCCATTCACATGTTGCGCG
GGCTGCTGGGCAAGATGCGCGAGCACCACAAGGTGGCGGTGATGGACGAAGCGCTGGTGCAGGCGGTGCG
CCTGTCCAGCCGCTACATCACCGGGCGCCAGCTGCCTGACAAGGCGGTCAGCGTGCTCGACACCGCCTGT
GCGCGCATTGCCCTGGCACAATCGTCGCAGCCTGGCTTGCTGGAAGACTGCCGTCGACAGATCGACAACC
TGCAGGCAGAAATTGACGTGCTCGGCCACGAAGCTGGCAAAGGCCACGACCATGCCCGCCGCTTGAGTGA
GCTGCAGGCCAGCCTGCAGGCCAAACAGCAGCAGGAACAGCAATTGAACGAGCAGTGGCAGCAAGAGCTG
GCGCTGGTCGAACAGCTCAAGGCGCTGGATGCCGCCAACGACGCCGATGCCGGGCAGCTCAATAGCCTGC
GCGCCGAACTGGCTCGCGTGCAAGGCGACCAGCCACTGGTGCACGCGCTGGTCGACAGCGGCGCCATCGC
CCAGGTCATCAGCGGCTGGACCGGCATCCCGCTGGGCAAGATGCTGCGTGACGAAATCGACACCGTACAG
CGCCTGCCCGCCCTGCTCGGCGAGCGCGTGCTGGGCCAGGACCATGCCCTGCACGAAATCGGCAAGCGCA
TCAAGATTTCCCGGGCGCGCATGGAAGACCCGAACAAGCCGATCGGTGTGTTCCTGCTGCTCGGCCCCAG
CGGCGTCGGCAAGACCGAAACCGCCCTGGCCCTGGCCGATACCCTGTACGGCGGCGAGCGCAACCTGATC
ACCATCAACATGTCCGAATACCAGGAGGCTCACACCGTGTCGAGCCTCAAGGGCTCGCCACCCGGCTACG
TCGGCTATGGCGAAGGCGGCGTGCTGACCGAGGCGGTGCGCCGCAAACCGTACAGCGTGGTGCTGCTCGA
CGAGGTTGAAAAAGCCCACCCGGACGTGCTCGAACTGTTCTTCCAGGTATTCGACAAGGGCGTACTGGAC
GACGGTGAAGGCCGCGAAATCAATTTCCGCAACACGGTGATCATCCTCACCTCCAACACTGGCACCGAGC
GCATCATGCAGACCTGCCTGAATGCCACCGAGCTCCCCACGCCGCAGGCCATCGTCGAAGGCCTGCGCGA
CGAACTCAATCATGTGTTCAAGCCGGCCTTCCTTGGCCGCCTGAGCATCGTGCCGTTCTACCCGGTGCAG
GACCAGATCCTGGAGCGCATCGTCGCCCTCAAGCTCGCGCGCATCGCCAAGCGCTTCGCCCGCAACCACC
AGGCCGAACTGAGCTACGACGAGGCGCTGGTCAAAGCTATCGCTGCGCGCTGCACCGAGGTCGACAGCGG
TGCGCGCAATATCGACAACATTCTGTCCCAGACCTTGATGCCCGAACTCGCCCAGCGCGTGCTCGAACGC
ATGGCCCAGGACACGCCCATCGAACGCCTGGTGATCGAATTGGGCAGCGATGGCGACTTTGCCTATCGCC
TGGCCTGA