SecReT6
Protein ID: 512685508
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24510
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2793819..2794808 [-]
Producthypothetical protein
NoteTssG
UniProt IDT2H5R8
KEGG IDppun:PP4_24510
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.20E-97, Aligned region: 2..306
Protein Sequence: 329 a.a.     [Download]
>gi|512685508|ref|YP_008113488.1| hypothetical protein PP4_24510 [Pseudomonas putida NBRC 14164]
MVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSDLHFEHAGKVSPAGLPLSQVQVTFMGLV
GPSGVLPRPYTELLLERHVQFRDDAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERTGSSGFDGYLLNLV
GLGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIHVKQFAGRWLHLPPEQRT
QLGRRNAQLGHSAVAGKRVWDYQSCIRIELGPLSLADYQRFQPGTECYRKLVELVRFYIGAGLDFEIAPR
LKREAVPCARLGRNGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL
 
Nucleotide Sequence: 990 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2794808-2793819 Pseudomonas putida NBRC 14164 DNA, complete genome
TTGGTCCGCCTGCTCCGCCTGCACTACAGCCGCACCGGGCGCATGGACCTGGCAACCCGGCCCCACGAAG
ACCCGCTGCGTTTCCGCACCCAGCTGTCGCTGGCGTTTCCGGCCAGCGAAGTCAGCGACCTGCACTTCGA
GCACGCAGGCAAGGTCTCGCCTGCCGGCCTGCCACTGTCGCAAGTGCAGGTTACCTTCATGGGCCTGGTC
GGGCCTTCAGGCGTGCTGCCGCGTCCGTACACCGAGTTGCTGCTTGAGCGCCATGTGCAGTTTCGAGACG
ATGCCGCCCATGCCTTTCTTGACATTTTCTCGCACCGCATGACCACGCTGTTCTACGAGGCCTGGCAAAA
ATACAAATTCCATATCGAGCACGAGCGCACTGGCAGCTCGGGCTTCGATGGCTACCTGCTCAACCTGGTG
GGCCTCGGCCCGCGGGCGCAGAAGCTCAAGTTTGAAGAACAACCGTCAGCATTGCGTCGCGAGCTGTTCA
GCTATTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAATGCGCTGAACCTCGAGCGCATGCTCGGCTTCTA
TTTCTCGCTGCCGATCCACGTCAAGCAGTTTGCCGGGCGCTGGTTGCACCTGCCGCCTGAGCAGCGCACC
CAGCTTGGCCGGCGCAACGCCCAGCTTGGCCACAGCGCCGTTGCTGGCAAGCGGGTGTGGGACTACCAAT
CGTGCATTCGCATTGAGCTGGGCCCACTGAGCCTGGCCGATTACCAGCGCTTCCAGCCTGGTACCGAGTG
CTATCGCAAACTCGTCGAGCTGGTGCGCTTCTATATAGGTGCCGGCCTGGACTTTGAAATCGCCCCGCGC
CTCAAGCGCGAGGCGGTACCGTGCGCCCGGCTCGGCCGCAACGGCAATGTCGCGTTGGGCTGGCTCGGCT
GGCTCAAACGCCCTGGCCGTGACGCGGAGCCTTCGCGTTGCGCCGTTTTCCATATTCCTTACGATGGGGT
CGCCTTGTGA