SecReT6
Protein ID: 512685509
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24520
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2794853..2796673 [-]
Productputative type VI secretion system protein
NoteTssF
UniProt IDT2H5U2
KEGG IDppun:PP4_24520
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-210, Aligned region: 5..606
Protein Sequence: 606 a.a.     [Download]
>gi|512685509|ref|YP_008113489.1| putative type VI secretion system protein [Pseudomonas putida NBRC 14164]
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIAELSLGRHEKVTEAYRVARHTEMHANAIEGVVCKFRTCYPVELWPIAV
QQASFVEMERSAFNGHSADLVAHLRIRLAATGDALFGQMQMDRLRFFLDGEATLMLHLYELLFNNLAKAT
LSFNDGGRSREVALPVDALKAVGYARDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILQGKA
IEQVDINFYFSEYDLGERLARLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAA
EVVSIDRVRRVRKLGGTDQVATCQPFFEPRGEQDPHSSFWVARRRAQGDATAMSIRVVDRDLELISASSD
TLSIALTCSNRDVPLMLPFGGERGDFNIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLIAHLSLNHMSL
VSQGREVLLELLSLYNYRNVSAIRKQINGIKAINSEPVVARIGHPRPNFVRGVGITLTLDEHQFTGSGVF
LFGMVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPARTGDQPLV
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2796673-2794853 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGCTCGACGAACTGCTGCCCTACTATGAAAAGGAACTGTCGCACCTGCGCTTCCTCGGCCAGGAGTTTG
CCGCGCAGTACCCGAAAATCGCTTCGCGCTTGCTGATCGAGGGCGACAACTGCGAAGACCCGCACACCGA
GCGTCTGATCGAGGCGTTCTCGTTCCTTTCTGCGCGGGTGCACAAGAAGCTCGATGACGAGTTTCCGGAA
ATCGTCGAATCCTTCCTTGAGGTGCTGTACCCCCATTACCTGCGCCCTACCCCCTCGATGTCGATTGCCG
AGCTGAGCCTGGGCAGGCACGAGAAAGTCACCGAAGCGTACCGGGTGGCGCGCCATACCGAGATGCATGC
CAACGCCATAGAGGGCGTGGTGTGCAAGTTCCGCACGTGCTACCCGGTAGAGCTGTGGCCGATTGCCGTG
CAACAGGCCTCGTTCGTCGAAATGGAACGTTCGGCCTTCAACGGCCACAGTGCCGACCTGGTCGCACACC
TGCGTATCCGCCTTGCAGCCACCGGCGATGCTCTGTTCGGGCAGATGCAAATGGACCGCCTGCGGTTTTT
CCTCGACGGCGAAGCAACGCTCATGCTGCACCTGTACGAGCTGCTGTTCAATAACCTGGCCAAGGCGACC
TTGAGCTTCAACGACGGGGGCCGCAGCCGTGAGGTCGCACTGCCCGTCGATGCCCTCAAGGCCGTAGGCT
ATGCCCGCGACGAAGGCCTGGTTGACTACTCGGAGCGCTCGTTCCTCGGTTACCGGCTGCTGCACGAATA
TTTCACGTTCCCCGACAAGTTCATGTTCTTCGACCTCAGTGGCTTTGCCCGCATTCTGCAGGGCAAGGCC
ATCGAGCAGGTCGACATCAATTTCTATTTTTCCGAATACGACCTTGGCGAGCGACTGGCGCGGTTGACCC
AGAATATCGGGCGCAACAACTTCAAGCTCAACTGCACGCCCATCATCAACCTGTTCCGCCAGCAAGCCGA
GCCGATCAAACTGACCCACACCCAGCACGAGTATCCGGTCACCCCGGACACCCGGCTGCACAACGCAGCA
GAAGTGGTATCCATAGACCGTGTGCGTCGGGTTCGTAAACTGGGGGGCACCGACCAGGTTGCCACTTGCC
AGCCGTTTTTCGAGCCGCGAGGCGAGCAAGACCCGCACAGCAGCTTCTGGGTTGCCCGGCGGCGCGCCCA
GGGTGACGCCACTGCCATGAGCATTCGCGTGGTCGACCGCGACCTGGAGCTGATCAGCGCCAGCAGCGAC
ACCCTCAGCATCGCCCTCACCTGCAGCAACCGCGATGTCCCGCTCATGCTCCCGTTCGGCGGCGAGCGTG
GCGATTTCAACATTCCCGCCAACTCGGTAATCAAGGATATCCGCTGCCTGCGCAAGCCCACCGCCACGGT
GCGCGTGCCATTGGGCAAAGGCTTGATATGGCGCCTGATCGCGCACCTGTCGCTGAACCATATGTCACTG
GTCAGCCAAGGCCGTGAAGTGCTGCTGGAGCTGCTGTCGCTTTACAACTACCGCAACGTCTCGGCCATCC
GCAAACAGATCAACGGCATCAAGGCCATCAACAGCGAGCCGGTAGTTGCGCGTATCGGCCATCCGCGGCC
GAACTTCGTGCGGGGCGTGGGCATTACCCTCACCCTCGACGAGCACCAGTTCACCGGCAGCGGCGTGTTC
CTGTTCGGCATGGTGCTGGACCACTTCTTCGGCCAGTACTGCTCGATGAACAGCTTCACGCAACTGACCC
TGCGCACCCAACAACGAGAAAAGAGAGTCGTCCAATGGCCAGCACGTACTGGCGATCAGCCCCTGGTCTG
A