SecReT6
Protein ID: 512685510
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24530
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2796673..2797155 [-]
Productputative type VI secretion system protein
NoteTssE
UniProt IDT2H8D1
KEGG IDppun:PP4_24530
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|512685510|ref|YP_008113490.1| putative type VI secretion system protein [Pseudomonas putida NBRC 14164]
MSNHARLLPSLLDRLLDDRPFQSAEPAAQRTCSLAEYKASIVRDLEVLVNTRQSLVAEELDGFSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQNGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2797155-2796673 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGAGTAACCACGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCGTTCCAGTCGG
CCGAGCCGGCCGCGCAGCGTACCTGCTCGCTGGCCGAGTACAAGGCCAGCATCGTCCGTGACCTTGAGGT
GCTGGTGAATACCCGCCAGTCCCTGGTCGCCGAAGAGCTCGACGGCTTCAGCCAGCTCGGTGGTTCCATC
CTTGAATACGGCATGCCCGACTTCATCAGCCGCAGCGTGCTCGACCCACATGACCGCCGCCTGATCCAGC
AACAGCTGGAGCGGGCGATCAGTACCGGAGACCGGCGTTTCCGCCGGGTCCGTGTGCAGCTGTTGGCCCA
GCAGAACGGCCACCGCATGTTGACCTTCCGCGTGGACGCCGTATTGCGTCTGCAGGACATCAGCCGCCAG
GTCTCGTTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA