SecReT6
Protein ID: 512685511
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24540
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2797182..2798684 [-]
Producthypothetical protein
NoteTssC
UniProt IDT2H714
KEGG IDppun:PP4_24540
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-196, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|512685511|ref|YP_008113491.1| hypothetical protein PP4_24540 [Pseudomonas putida NBRC 14164]
MTDKQTAPQQAGELVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDSMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAASAHAPFISAASPELFGWDSF
TEMSGPRDLANLFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2798684-2797182 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGAACTGGTCGAAGTAGAAAACTTCGCGCCACAGC
CCTCACTGCTGGACAGCATCATTTCGCAAAGCCGCGTGGCCCGTTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATTGGCGAATTGGTGAACCAGGTGCTCGAAGGTGAGATGACGCCGAGCAAAGACCTGATCGCC
GTGCTCGACTCGCGTATCGCCGAGATCGATTCGATGCTCTCCGAGCAGATGAACGAGATCATGCACGCCC
GCGAGTTCCAGCAGCTGGAAGCCTCCTGGCGCGGCCTGAAATACCAGGTAGACCAGACCGAAACCAGCAC
CACGCTGAAGATCCACCTGCTCAACGCCTCGAAGAAGGACCTGGTACGTGACCTGAAGGCCGCCAGCGAA
TTCGACCAGAGCGCGCTGTTCAAGAAAGTCTACGAAGAAGAATACGGCACTTTCGGTGGCGCGCCGTTCG
GTATGCTGATCGGTGACTACGAGTTCAACCGCAACCCCGAAGACATGTACTTGCTGGAAGAGATCTCGCA
CGTGGCAGCGTCGGCGCATGCACCGTTCATCTCCGCCGCCTCCCCCGAGCTGTTTGGCTGGGACTCGTTC
ACCGAGATGTCCGGCCCGCGTGACTTGGCAAATCTCTTCGACACCGTCGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCGGAAGACTCACGCTACGTCGGCCTCACCCTGCCCCACGTGCTCGGCCGCCTGCCATATGG
CCCTGATACCACGCCGGTGGAAGAATTCAACTTCGTCGAAAGCGTCGACGGCCGCGACCACAACAAGTAC
CTGTGGATGAACGCCGCCTATGCCCTCGGCACCCGCGTCACCGATGCTTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGCGTAGAAGGTGGCGGCCTGGTCGAAGGCTTGCCAACCCATACCTTCAAGACCGACGA
CGGCGAAATCGCCCTCAAGTGCCCGACCGAGATCGCCATCACCGACCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATTCCCCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAGCAAAAGCAATACAACACCGACATCGCCAACGCCAACGCACGCCTGTCGGCCCAGCTGCAGTACAT
CTTCGCCACGTCGCGCATCGCCCATTACATGAAGGCAATCATGCGCGACAAAATCGGCAGCTTCGCCTCG
CGCATGGACGTGGAGCGCTTCCTCAACCAGTGGCTGGCCAGCTACGTGCTGCTGGACGACACCGCCAGCC
AGGAGGCCAAGGCCAAGTTCCCGCTGCGCGAAGCCCGCGCCGAGGTGTTCGAGGTACCAGGCAAGCCAGG
CGTGTACAAGGCTGTAACCTACCTGCGCCCGCACTACCAGCTCGACGAACTGACCGCCTCGCTGCGCCTG
GTCGCCGAACTGCCTCAAGGGGCGCGCGGCTGA