SecReT6
Protein ID: 512685512
SecReT6 ID811
T6SS typei4b
Gene symbol-
Locus tagPP4_24550
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2798699..2799274 [-]
Producthypothetical protein
NoteTssB
UniProt IDT2H7A8
KEGG IDppun:PP4_24550
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-60, Aligned region: 2..25
DUF770 [PF05591], Evalue: 2.20E-60, Aligned region: 23..177
Protein Sequence: 191 a.a.     [Download]
>gi|512685512|ref|YP_008113492.1| hypothetical protein PP4_24550 [Pseudomonas putida NBRC 14164]
MIRSELLALENTMAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLK
DRKFVFIDRDNFNGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRN
KLADLRNKMGGNDKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSSDRA
 
Nucleotide Sequence: 576 bp     [Download]
>gi|512683057|ref|NC_021505.1|:c2799274-2798699 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGATTCGCAGCGAACTGCTAGCACTGGAGAACACGATGGCGAAGAAGGAAAGCACCCAGCACAAACTCG
ACCGCGTCCGCGCGCCGCGGGTCCATATCACCTACGACGTGGACATCGGCGATGCCATCGAGAAAAAGGA
GCTGCCCTTCGTCGTCGGCGTACTGGGCGACTTTTCCGGCAACCCGCTGGAGCCGCTGCCCAAGCTCAAG
GACCGCAAGTTCGTCTTCATCGACCGGGACAACTTCAACGGTGTGCTCAAGGGCATCAAGCCACGCCTGA
CCTACCGGGTCGACAACACCCTGGCCAAGAACGGCACCCAGCTAGGCGTGGAGCTGAACTTCAACAGCCT
TGAAGACTTCGAGCCACAGAACGTGGTCAAGCAGGTCGAGCCGCTGCGCAAGCTGCTTGAAGTGCGCAAC
AAACTGGCCGACCTGCGCAACAAGATGGGCGGCAACGACAAGCTCGAAGAGCTGCTGATGGACGTGCTGC
AGAACACCGAAAAACTCAAGACCCTGGGCAAGGAATTCGGCCGTGAAGCCGAAGTGAAAGACCCATCCAG
CAGCGATCGCGCCTGA