SecReT6
Protein ID: 512685523
SecReT6 ID811
T6SS typei4b
Gene symbolvgrG
Locus tagPP4_24660
StrainPseudomonas putida NBRC 14164
Repliconchromosome [GenBank: NC_021505] [Browse all T6SS(s) in this replicon]
Location [Strand]2807486..2809342 [+]
Productputative type VI secretion system effector VgrG
NoteTssI
UniProt IDT2H5T0
KEGG IDppun:PP4_24660
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-80, Aligned region: 38..347
Phage_base_V [PF04717], Evalue: 1.40E-23, Aligned region: 381..474
Gp5_C [PF06715], Evalue: 5.90E-06, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 5.90E-06, Aligned region: 553..565
DUF2345 [PF10106], Evalue: 0.00048, Aligned region: 564..612
Protein Sequence: 618 a.a.     [Download]
>gi|512685523|ref|YP_008113503.1| putative type VI secretion system effector VgrG [Pseudomonas putida NBRC 14164]
MIMDLASALLSPQNRRLFKFHNLANPEQELLLETFKGTEALSRAFNYELLLVCEDSGVPLKSMMGQHVSI
EIELAEGGPRYITGYLTRFASIGSDGGMARYTATLNPWFSMLKNRFDTRIFQGNTVEEVVTEVFALCPAF
SRHEFRLTRPQKRYTYITQYRETDFNFVQRLLEEEGMFYYFEHTAEGHTMIICDDSSTLVAIPEQPQIRF
HSASVTETADSITQWSGNRQLQSGKMATQTFDYRQPNNRLPVALNSVNKQGDVENFEIYDFPGQYTHGTY
DEGETLLRLRIEALELRGKKFEGASNCRAMKPGYTFELLQHYIHDQGPLEDRQFLLMSVESEGHNNYLTG
QQASYFNTFSCVRKKIPFRPQLSTPKPTIAGPQTAIIVGPPGEEIFTDELGRVKIQFHWDRNGKYNDHSS
CWVRVAQSGASGGFGSIQIPRIGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKTQSGFLTRSMK
GDGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRSITVGGTHTETVKKDTVVQVTEGSYT
LQVDNQFIQVAAKQHIILQVGDSSITLTPEGIEIKGKVIVTTSTDTTQITGAAVRIND
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|512683057|ref|NC_021505.1|:2807486-2809342 Pseudomonas putida NBRC 14164 DNA, complete genome
ATGATCATGGACTTGGCCTCCGCGCTGCTGTCGCCACAGAACCGCCGCCTGTTCAAGTTTCACAACCTGG
CCAACCCCGAGCAGGAGCTGCTGCTGGAAACCTTCAAGGGCACCGAAGCCCTGTCGCGGGCGTTCAACTA
CGAACTGCTGCTGGTCTGCGAAGACTCCGGCGTGCCGCTCAAATCCATGATGGGCCAGCACGTCAGCATC
GAGATCGAACTGGCCGAAGGCGGCCCGCGGTACATAACCGGCTACCTCACACGCTTTGCCAGCATCGGCA
GCGACGGCGGCATGGCGCGCTATACCGCTACCCTCAACCCGTGGTTCTCGATGCTGAAGAACCGCTTCGA
CACGCGGATCTTCCAGGGCAACACGGTCGAGGAAGTGGTCACCGAAGTGTTCGCCCTGTGTCCGGCGTTT
TCCCGCCACGAGTTTCGCCTGACCCGGCCACAGAAGCGCTACACCTACATCACCCAGTACCGCGAAACCG
ACTTCAACTTCGTCCAGCGCCTGCTGGAGGAAGAGGGGATGTTCTACTACTTCGAGCACACCGCCGAAGG
CCACACCATGATCATCTGCGATGACTCCAGCACGCTGGTGGCCATCCCCGAGCAACCGCAAATCCGCTTC
CACAGCGCCTCGGTCACCGAGACCGCCGACTCCATCACCCAGTGGAGCGGCAACCGTCAACTGCAATCCG
GCAAGATGGCCACGCAAACCTTTGACTACCGCCAACCGAACAACCGCCTGCCGGTGGCGCTGAACAGCGT
GAACAAGCAGGGCGATGTCGAGAACTTCGAGATCTACGACTTCCCCGGCCAGTACACCCACGGTACCTAT
GACGAAGGCGAAACCCTGCTGCGCCTGCGCATTGAGGCGCTGGAGCTGCGCGGCAAGAAGTTCGAAGGTG
CCAGTAACTGCCGGGCCATGAAGCCAGGCTATACCTTCGAGCTGCTGCAGCACTACATCCACGACCAAGG
CCCGTTAGAAGACCGCCAGTTCCTGCTGATGAGCGTGGAAAGCGAAGGCCACAACAACTACCTTACCGGC
CAGCAGGCCAGCTACTTCAACACCTTCAGTTGCGTGCGCAAGAAGATCCCGTTCCGCCCGCAGCTGAGTA
CGCCCAAACCGACCATTGCCGGCCCGCAGACCGCGATCATCGTCGGCCCACCGGGTGAGGAGATCTTCAC
CGACGAACTAGGCCGGGTGAAGATCCAGTTCCACTGGGACCGCAATGGCAAGTACAACGATCACAGCTCT
TGCTGGGTACGTGTCGCCCAGTCCGGTGCCAGCGGCGGCTTCGGCAGCATTCAGATCCCACGCATAGGCG
ACGAAGTGGTTGTGGTGTTCCTCGACGGCAACCCGGACCGGCCGCTGATCATGGGCAGCCTTTACAACAG
CACCAACACCCCGCCATGGTCGCTGCCGGCGAACAAGACCCAGAGTGGGTTCTTGACACGTTCGATGAAG
GGTGACGGCGGTACCGCCAACTTCTTCCGCTTCGAAGACAAGGCCGGCGCCGAGCAGATCATCATGCATG
CCGAGCGCAACATGGATACCGAAATCGAGCTGGATGAGACCCATGATGTAGGGAACAACCGCTCGATCAC
GGTTGGCGGTACGCACACCGAAACGGTCAAGAAAGACACCGTGGTGCAAGTGACCGAAGGTTCTTACACC
CTGCAGGTCGACAACCAGTTCATCCAGGTGGCCGCCAAGCAGCACATCATCCTGCAGGTGGGCGACAGCA
GCATCACGCTGACCCCGGAAGGCATCGAGATCAAAGGCAAGGTCATCGTGACCACCAGTACCGATACTAC
CCAAATCACTGGCGCCGCAGTGCGGATCAACGACTGA