SecReT6
Protein ID: 514407707
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00405
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]96052..97401 [-]
Producttype VI secretion protein
NoteTssL
UniProt IDR9Z7Y7
KEGG IDprp:M062_00405
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-70, Aligned region: 66..271
OmpA [PF00691], Evalue: 8.60E-16, Aligned region: 339..437
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 90..139
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 202..268
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 336..369
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 397..434
Protein Sequence: 449 a.a.     [Download]
>gi|514407707|ref|YP_008130547.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSGRGDGLNPLEQ
AAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWG
STSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEAL
RERTAAVIRSTRGEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFK
RIHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDE
FQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c97401-96052 Pseudomonas aeruginosa RP73, complete genome
ATGCCTCCCATCGACGATCCCTTCGGCACCCCGGCCGGCGGCGGCAACGGAAGCCCGCCCGACGACCGCA
CCATGATCATGCCGCGTCCCGGCGGCCGCGCCCCGGAACCGGCCGGCGGCCCCCGCGGCGGCGATCCCTA
CACGCCGCCGCCGATGGCCAGCCTGGCGCCGCTGAGCGGCCGCGGCGACGGCCTCAACCCGCTGGAGCAG
GCCGCCGGCCCACTGCTGGCGATGCTCACCCGCCTGCGCAACACCATCGCCCATCCGGCGCCGGCCAGCC
TGCGCGCGCAACTGCTCGGCTACCTGCGCCAGTTCGAGGAGAAGGCACGCCAGGCCGGCGTGGCGCCGGA
CGAAGTGATGCTGGCGCGCTACGTGCTCTGCACCGCCCTCGACGAAGCGGTGCTCAGCACGCCGTGGGGC
AGCACCAGCGACTGGGGCAAGCAGAGCCTGCTGATCACCCTGCACAACGAGGCCTGGGGCGGCGAGAAGG
TCTTCCAGTTGCTCGAACACTGCCTGCAGAACCCGCACCAGCGCCTGCACCTGCTGGAGCTGCTGTACCT
GTGCACCAGCCTCGGCTTCGAAGGCCGCTACCGGGTCATGCACGACGGCCGCAGCCAACTGGAGGCGCTG
CGCGAGCGCACCGCGGCGGTGATCCGCAGCACCCGCGGCGAGTACGAGCACGAACTGTCGCCGCACTGGC
GCGGCCTCAGCGTGATGCGCGACCGCCTTTCGCAATACCTGCCGCCGTGGGTCGGTATCGCCATCGGCCT
GGCCTTGCTGCTGGCCTTGCTGTTCGGCCTGCGGATGAAGCTGGCCGCCGACGCCGAGCCGGTGTTCAAG
CGCATCCACGCCATCGGCGAGATCCCGGTGCAGGCCATCGACCGCCCGGCGGTGCAGCCGCGGGTGATCG
AGCGGCCACGCCTGGCGCGCTTCCTCGCCGACGACATCAAGGCCCAGCGGGTGGCGGTGGAGGACGCCGT
CGACCGCTCGGTGGTGACCATCCGCGGCGACGAGCTGTTCGCCAGCGCCAGCGCCAGCGTGCGCGACGAG
TTCCAGCCGCTGCTGCTGCGCATCGCCGACGCCCTGCGCAAGGTCAAGGGCCAGGTGCTGGTCACCGGCC
ATAGCGACAACCGGCCGATCGCCACGCTGCGCTACCCGTCCAACTGGAAACTGTCCCAGGCCCGTGCCCA
GGAGGTCGCCGACCTGCTCGGCGCGACCACCGGCGACGCCGGCCGCTTCACCGCCGAAGGGCGCAGCGAC
ACCGAGCCGGTGGCGACCAATGCCAGCGCCGAAGGCCGCGCACGCAACCGCCGGGTGGAAATCACCGTAT
TCGCGGAGGGCGCGCAATGA