SecReT6
Protein ID: 514407708
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00410
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]97408..98742 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDR9Z9Z5
KEGG IDprp:M062_00410
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-158, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|514407708|ref|YP_008130548.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGFSELKLDDALLTQGKLAIVSARGVLP
DGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPLKRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFES
RAPVALGSQAFRLLTERDGLGEYAAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLL
HQRGEALAGRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQ
RRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLIDNASFVLVVR
ADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPYHAGSTYFELDRGSAHWKQLTH
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c98742-97408 Pseudomonas aeruginosa RP73, complete genome
ATGTCCTGGAATAACCGCGTGGTGTGGTCCGAAGGCATGTTCCTGCGGCCACAGCATTTCCAGCAGCACG
ACCGCTACCTGGAAACCCTGGTGGATGGCCGCTGCCGCTCGCTCCTAGCGGGCGGCTGGGGCTTTTCCGA
GCTGAAGCTGGACGATGCCCTGCTGACCCAGGGCAAGCTGGCCATCGTCAGCGCCCGCGGCGTGCTGCCG
GATGGTACGCCGTTCAACATCCCCGCCGACGATCCGGCGCCGGCGCCGCTGAATGTCGAGGAAAGCCTGC
GCGACGGCATCGTCTACCTCGGCCTGCCGCTGAAGCGGGTCGGCACCCGCGACACGGTGGAGGAGGGCGA
GGCCCTCGGCGGCGCCCGCTACGTCAGCCAGGTGCAGGAAGTGCGCGACGACAATGCCGCCTTCGAGAGC
CGCGCGCCGGTGGCCCTGGGCAGCCAGGCGTTCCGCCTGCTGACCGAGCGCGACGGCCTCGGCGAATACG
CCGCGGTGGGCGTCGCGCGGGTCCGCGAGAAGCGCGCGGACCAGGCCCTGAGCCTGGACGAGGACTACCT
GCCGCCGGTACTCGACATTGCCGCCGCGCCGCCCCTGGCGTCCTTCGCCAAGGAGCTGCTGGGCCTGCTC
CACCAGCGCGGCGAAGCCCTCGCCGGGCGGGTGGTGGCCTCCAGCGCCGGGGGCGCCTCGGAAATCGCCG
ACTTCCTGCTGCTGCAACTGGTCAACCGCGCCGAGGCCCTCACCGGTCACCTGTCCCGCGTGCGCCCGCT
GCACCCGCAGGAGCTGTACCGCGAACTGGTGGCCCTGGCCGGCGAGTTCTGTACCTTCACCGCCAGCCAG
CGGCGTCCCGAGGAGTACCCGGTGTACAACCACGACGACCTGGCCGCCAGCTTCGCCCCGGTGATGCTCG
CCCTGCGCCAGGCGCTGGCGACGGTGATCGACGCCAAGGCGATCGCCATCCCGATCGTCGAGAAGGCCTA
CGGCGTGCACGTCGCGATGCTCAGCGACCGCAGCCTGATCGACAACGCCAGCTTCGTCCTGGTGGTGCGC
GCCGACGTCCCCGGCGAGAGCCTGCGCGGGCACTTCCCGCAGCAGGCCAAGGTCGGCTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAACTGCCGGGTATCGGCCTGCTGCCGATGCCGGTGGCGCCGCGGCAGAT
CCCCTACCACGCCGGCTCCACCTATTTCGAACTGGACCGCGGCAGCGCGCATTGGAAGCAGCTGACGCAC
TCCGGCGGCTTCGCCTTCCACATCGCCGGCCAGTTCCCCGGGCTGAACCTGGCCTTCTGGGCCATTCGAG
GATAA