SecReT6
Protein ID: 514407710
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00425
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]101158..102192 [+]
Producttype VI secretion protein ImpA
NoteTssA
UniProt IDR9Z8G6
KEGG IDprp:M062_00425
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-18, Aligned region: 54..113
ImpA-rel_N [PF06812], Evalue: 3.20E-18, Aligned region: 156..168
Protein Sequence: 344 a.a.     [Download]
>gi|514407710|ref|YP_008130551.1| type VI secretion protein ImpA [Pseudomonas aeruginosa RP73]
MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDAVLPAEPPEWPRVRALASELFGRSKD
LRVANLLLQSNVALDGLDGLADGLLLVRELLGQYWDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVW
AIPLVRSRAFGPVNLRAALNAAGLQRFASETLSPEQIAGAFADADADALAATRRALEGAQEHALAIESGV
AERVGSAQGLDLGPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAAADEQGGAAPVAAVAAPAPRASGEIA
NREDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRGPESE
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|514407635|ref|NC_021577.1|:101158-102192 Pseudomonas aeruginosa RP73, complete genome
GTGCTGGATGTACCCGTTTTGCTGGCTGCCGTATCCCCGGACTCGCCCTGTGGCGACGATCTGGAGTACG
ACGCCGCGTTCCTCGAACTCGAACGCATCGCCCAGGGCCAACCCGAGCGCCAGATGGGCGATGCCGTGCT
GCCCGCCGAACCGCCGGAGTGGCCGCGCGTACGCGCGCTGGCCAGCGAACTGTTCGGCCGTAGCAAGGAC
CTGCGGGTAGCCAACCTGCTGCTGCAGAGCAACGTCGCCCTCGACGGCCTGGACGGGCTCGCCGACGGCC
TGCTGCTGGTCCGCGAGCTGCTCGGCCAGTACTGGGACGGCGTCTATCCGCTGCTCGACGCCGATGACGA
CAACGACCCCACCTTCCGTATCAACGCCCTCACCGGCCTGGTCGCCGAACCGTTGCTGCAACTGGTCTGG
GCGATCCCGCTGGTGCGCTCGCGGGCGTTCGGCCCGGTCAACCTGCGCGCCGCGCTGAACGCCGCCGGGC
TGCAACGCTTCGCCAGCGAGACCCTGAGTCCCGAGCAGATCGCCGGCGCCTTCGCCGATGCCGACGCCGA
TGCGCTGGCCGCCACCCGGCGCGCCCTGGAAGGCGCCCAGGAACATGCCCTGGCCATCGAGAGCGGCGTC
GCCGAACGGGTCGGCTCGGCCCAGGGACTCGACCTCGGTCCCCTTCGTCAACTGCTGCGCCAGGCCCTCC
AGGTGTTCGACCTGTACGGCCCGCAGGGCGCCGGCGAGCCCTTGGCGCCGGGCGCCGAAGCGGCCGCCGA
CGAGCAGGGGGGCGCCGCGCCTGTCGCAGCCGTCGCCGCGCCGGCACCGCGAGCCAGCGGCGAGATCGCC
AACCGCGAAGACGTCCTGCGCCAGCTCGACCGCCTGCTCGAGTATTACGTTCGCCACGAGCCGTCGAGCC
CGGTGCCGGTGCTGCTCAAGCGCGCCAAGACACTGGTGACGGCCGACTTCGCCGAAATCGTGAGGAATCT
CATCCCCGATGGGATTTCCCAGTTCGAAACCCTGCGAGGCCCGGAAAGCGAGTAA