SecReT6
Protein ID: 514407712
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00435
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]102812..104308 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDR9Z7Y9
KEGG IDprp:M062_00435
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-195, Aligned region: 67..493
Protein Sequence: 498 a.a.     [Download]
>gi|514407712|ref|YP_008130553.1| EvpB family type VI secretion protein [Pseudomonas aeruginosa RP73]
MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALEQTSLISNDAIKSIESI
IAAIDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQ
SPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWA
NSAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVS
KLPSAKEA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|514407635|ref|NC_021577.1|:102812-104308 Pseudomonas aeruginosa RP73, complete genome
ATGGCCGAATTGAGCACCGAGAACCTGGCCCAGGGCCAGACCACCACCGAGCAGACCAGTGAGTTCGCCA
GTCTGCTGCTGCAGGAGTTCAAGCCCAAGACCGAGCGCGCCCGCGAAGCGGTGGAGACCGCCGTGCGGAC
CCTCGCCGAGCATGCCCTGGAGCAGACCAGCCTGATCTCCAACGACGCGATCAAGTCGATCGAGTCGATC
ATCGCGGCGATCGACGCCAAGCTCACCGCGCAGGTCAACCTGATCATGCACCACGCCGACTTCCAGCAAC
TGGAAAGCGCCTGGCGCGGCCTGCACTACCTGGTCAACAACACCGAGACCGACGAGCAACTGAAGATCCG
CGTGCTGAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACCACCTGGGACCAG
AGCCCGATCTTCAAGAAGCTCTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTATGGCTGCCTGG
TCGGCGACTACTACTTCGACCAGTCGCCGCCGGACGTCGAGCTGCTCGGCGAGATGGCGAAGATCTCCGC
CGCCATGCACGCGCCGTTCATTTCCGCCGCCTCGCCGACGGTGATGGGCATGGGTTCCTGGCAGGAACTG
TCCAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGTTCGCTGCGCGAGT
CCGAGGACTCCCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGGGCGAAGAC
CGATCCGGTGGAAGAGTTCGCCTTCGAGGAAGAAACCGACGGCGCCGACAGCAGCAAGTACGCCTGGGCC
AACTCGGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCTCTACGGCTGGTGCTCGCGGATCC
GCGGCGTCGAGTCCGGCGGCGAGGTGCAGGGCCTGCCGGCGCACACCTTCCCCACCGACGACGGCGGCGT
GGACATGAAGTGCCCGACCGAGATCGCCATTTCCGACCGCCGCGAGGCGGAGCTGGCGAAGAACGGCTTC
ATGCCGCTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCGCAGTCGCTGCAGAAACCCG
CCGAGTACGACGATCCGGACGCCACCGCCAACGCCAACCTGGCGGCGCGCCTGCCCTACCTGTTCGCCAC
CTGCCGCTTCGCCCATTACCTGAAGTGCATCGTTCGCGACAAGATCGGTTCCTTCAAGGAGAAGGACGAG
ATGCAGCGCTGGCTGCAGGACTGGATCCTCAACTACGTCGACGGCGACCCGGCCCACTCCACCGAGACCA
CCAAGGCCCAGCACCCGCTGGCGGCGGCCGAAGTGGTGGTGGAGGAAGTCGAAGGCAATCCGGGTTACTA
CAACTCGAAGTTCTTCCTTCGCCCGCACTACCAGCTCGAGGGACTGACGGTATCGCTACGCCTGGTATCC
AAGCTGCCTTCGGCCAAAGAGGCCTGA