SecReT6
Protein ID: 514407714
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00445
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]105040..105885 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDR9ZAM7
KEGG IDprp:M062_00445
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.70E-43, Aligned region: 159..276
TPR_16 [PF13432], Evalue: 1.80E-07, Aligned region: 21..74
TPR_16 [PF13432], Evalue: 1.80E-07, Aligned region: 132..150
TPR_19 [PF14559], Evalue: 2.60E-05, Aligned region: 26..82
TPR_19 [PF14559], Evalue: 2.60E-05, Aligned region: 131..151
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 20..59
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 56..73
TPR_14 [PF13428], Evalue: 0.0001, Aligned region: 113..141
TPR_11 [PF13414], Evalue: 0.0038, Aligned region: 23..71
TPR_11 [PF13414], Evalue: 0.0038, Aligned region: 122..139
BTAD [PF03704], Evalue: 0.007, Aligned region: 14..71
BTAD [PF03704], Evalue: 0.007, Aligned region: 136..144
Protein Sequence: 281 a.a.     [Download]
>gi|514407714|ref|YP_008130555.1| virulence protein, SciE type [Pseudomonas aeruginosa RP73]
MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQWARAQ
NQLKVVGELDASALPMVQTYSTAIDCEALRREVFAGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQA
LREQAFDAAPAVPGRIGEAPFAWLADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPA
ELTLANGGATVALLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTD
A
 
Nucleotide Sequence: 846 bp     [Download]
>gi|514407635|ref|NC_021577.1|:105040-105885 Pseudomonas aeruginosa RP73, complete genome
ATGGCCGACCCTTCATTCGCATCCGGGCGCCTGGGCTCCCGGCTACAGGGAAGTATCGCGATGATCGCCG
AAGAACTGTTGCGCGCCGGGCGCCTGGACGATGCCTTGAAAGCCTTGCAGGAACAGGTGCGCAGCCAGCC
GTCGAACGCTACCCTGCGGATCTTCCTGTTCCAGCTGCTGGCCGTGATGGGCCAGTGGGCGCGGGCGCAG
AACCAGCTCAAGGTGGTCGGCGAACTGGATGCCTCGGCGCTGCCGATGGTACAGACCTACTCCACCGCCA
TCGACTGCGAGGCGCTGCGCCGCGAGGTGTTCGCCGGGCGCCTGACGCCGGTGATCCTCGGCCAGCCGGC
GGAATGGATCGCGCCGCTGTTGCAGGCCCTGAGCCTGGACGCCGAAGGCCATGGCGAGGCCGCCCAGGCC
CTGCGCGAGCAGGCCTTCGACGCCGCGCCGGCGGTGCCCGGGCGGATCGGCGAAGCGCCGTTCGCCTGGC
TGGCGGATGCCGACACGCGCCTCGGCCCGGTGCTCGAGGTAATCGTCAACGGTCGCTATGCCTGGTTGCC
GATGAGCAACCTGCGCAGCCTCAAGGTCGAGGCGCCGAGCGACCTGCGCGATCTGGTCTGGCTGCCGGCC
GAACTGACCCTGGCCAACGGTGGCGCCACCGTCGCGCTGCTGCCGGCGCGCTACGCGGAAACCGTCGAGC
ACGGCGACGACGCCGCGCGCCTGGGGCGCAAGACCGAATGGCTGGACAGCGGCCTGCCGGTCGGCCAGCG
GCTGTTCGTCACCGATGCCGGCGAGACCGCGCTGTTCGACCTGCGTGAACTGGACTTCGAGCCGACGGAC
GCCTGA