SecReT6
Protein ID: 514407715
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00450
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]105887..106396 [+]
Producthypothetical protein
NoteTssE
UniProt IDR9Z8G8
KEGG IDprp:M062_00450
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-23, Aligned region: 36..145
Protein Sequence: 169 a.a.     [Download]
>gi|514407715|ref|YP_008130556.1| hypothetical protein M062_00450 [Pseudomonas aeruginosa RP73]
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLNQLKASVLRDLAWLFNTTSLFDHGPAARMPAGN
SVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAE
PAPLRLLLTTNLDLETGHVRVAQGERRRT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|514407635|ref|NC_021577.1|:105887-106396 Pseudomonas aeruginosa RP73, complete genome
ATGGCCGAACTGACCCTCCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTCACCGACGACGAGCCGG
GCAACCTCAAGGAAGCCGCGGAGCGCCGGGTGCTGACCCTGAACCAGCTGAAGGCCTCGGTGCTGCGCGA
CCTGGCGTGGCTGTTCAACACCACTTCGCTGTTCGACCACGGCCCCGCCGCACGGATGCCGGCCGGCAAC
TCGGTGCTCAACTACGGGCTGCCGGCGCTGGCCGGGCACACCGCGTCGAGCGTCGACGTGCATGCCATCG
AGGCGCTGCTCACCGAGACCATCGCCACCTTCGAGCCGCGCATCATCCGTTCTTCGTTGCGGGTGCGCGC
GCAACTGCTGCCCGGCGAGATGGACCACAACGCCCTGAGCTTCGAGATCGAGGGTGATCTCTGGGCCGAA
CCGGCGCCGCTGCGCCTGCTGCTGACCACCAACCTGGACCTGGAGACCGGCCACGTGCGCGTCGCCCAGG
GCGAGCGGAGGCGTACATGA