SecReT6
Protein ID: 514407719
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00470
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]112001..113941 [+]
Producttype VI secretion protein ImpA
NoteTssI
UniProt IDR9ZAN2
KEGG IDprp:M062_00470
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-88, Aligned region: 29..329
Phage_base_V [PF04717], Evalue: 2.00E-26, Aligned region: 369..462
Protein Sequence: 646 a.a.     [Download]
>gi|514407719|ref|YP_008130560.1| type VI secretion protein ImpA [Pseudomonas aeruginosa RP73]
MGLMQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMSLSLELPGGSR
RFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRP
YREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHILVLSDAYGAHRSPAGYASVPYYPPTLGHRER
DHFFDWQMAREVQPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIE
AIQAQHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCI
DASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRTRAVKLNDTLLVGGAKSDSVT
GTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQG
TIDGQVQAMFPPPAKG
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|514407635|ref|NC_021577.1|:112001-113941 Pseudomonas aeruginosa RP73, complete genome
ATGGGATTGATGCAACTGACCCGCCTGGTCCAGGTGGATTGCCCGCTGGGGCCGGACGTGCTGCTGTTGC
AGCGCATGGAGGGACGCGAGGAACTGGGACGGCTGTTCGCCTACGAGCTGCACCTGGTATCGGAAAATCC
CAACCTGCCGCTGGAGCAGTTGCTCGGCAAGCCGATGAGCCTGTCGCTGGAGCTGCCCGGCGGCAGCCGG
CGCTTCTTTCACGGCATCGTCGCGCGCTGTAGCCAGGTGGCCGGGCACGGCCAGTTCGCCGGCTACCAGG
CCACCCTGCGGCCCTGGCCGTGGCTGCTGACGCGCACCTCGGACTGCCGCATCTTCCAGAACCAGAGCGT
GCCGGAGATCATCAAGCAGGTGTTCCGCGACCTCGGCTTTTCCGATTTCGAGGATGCCCTCACGCGCCCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTCGACTTCATCAGCCGGCTGATGGAAC
AGGAAGGCATCTACTACTGGTTCCGCCATGAGCAGAAGCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCATCGCAGCCCGGCTGGCTACGCCAGCGTGCCGTACTACCCGCCGACCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCAGATGGCACGCGAGGTCCAGCCCGGTTCGCTGACCCTCAACGACTACGACT
TCCAGCGCCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGGCCGCACGCGGCGGCCGACTACCC
GCTGTACGACTATCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGCAACCGCATCGAG
GCGATCCAGGCGCAGCACGAGCGCGTGCGCCTGCGCGGCGTAGTGCGCGGGATCGGCGCCGGGCACCTGT
TCCGCCTGAGCGGCTATCCGCGCGATGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAATACCGGGT
GGTCCAGGAACTCTACGAAACCGGCAGCGGCGGCGCCGGCTCGCAGTTCGAGAGCGAGCTGGACTGCATC
GACGCCAGCCAGTCGTTCCGTCTCCTGCCGCAGACTCCGGTACCGGTGGTGCGAGGTCCGCAGACCGCGG
TGGTGGTCGGACCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGATCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGTTCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTATACATCCACGCCGAGCGCAACCAGGACAACCTGGTCGAGAACG
ATGCCTCGCTGTCGGTCGGCCACGACCGCAACAAGAGCATCGGCCACGACGAGCTGGCGCGCATCGGCAA
CAACCGCACCCGCGCGGTGAAGCTCAACGACACCCTGCTGGTGGGCGGGGCGAAGAGCGACAGCGTCACC
GGCACCTACCTGATCGAGGCCGGCGCGCAGATCCGCCTGGTCTGCGGCAAGAGCGTGGTGGAGTTCAACG
CCGACGGCACCATCAATATCTCCGGCAGCGCCTTCAACCTCTACGCCAGCGGCAACGGCAACATCGACAC
CGGCGGCCGCCTCGACCTCAATTCCGGCGGCGCCAGCGAGGTCGACGCCAAGGGCAAGGGCGTGCAGGGC
ACCATCGACGGCCAGGTACAGGCGATGTTTCCGCCGCCGGCGAAGGGCTGA