SecReT6
Protein ID: 514407722
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00490
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]116332..118557 [+]
Producttype VI secretion protein ImpA
NoteTssI
UniProt IDR9Z800
KEGG IDprp:M062_00490
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-89, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 2.80E-89, Aligned region: 346..380
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 529..552
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 562..584
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 586..608
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 594..616
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 610..632
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 633..656
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 658..675
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 715..731
Phage_base_V [PF04717], Evalue: 2.40E-26, Aligned region: 369..462
Protein Sequence: 741 a.a.     [Download]
>gi|514407722|ref|YP_008130564.1| type VI secretion protein ImpA [Pseudomonas aeruginosa RP73]
MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPASLALELHDGSR
RHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRER
DHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIE
ALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCI
DAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVG
NNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETIS
IGADRSESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASI
RMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN
 
Nucleotide Sequence: 2226 bp     [Download]
>gi|514407635|ref|NC_021577.1|:116332-118557 Pseudomonas aeruginosa RP73, complete genome
ATGGCACTTGCGCAACAGACCCGCCTGGTCCGGGTCGACAGTCCGCTCGGCGCGGAGGTCCTGCAATTGC
AGCGAATGGAGGGTCGCGAAGAGCTCGGCCGGCCGTTCGCCTACGAGCTGGAACTGATCTCGGAAAACCC
CGACCTGCCACTCGACGGGCTGCTGGGCAAGCCGGCCAGCCTGGCGCTGGAACTGCACGACGGCAGCCGG
CGGCATTTCCACGGCATCGTCGCCGCTTGCAGCCAGGGATCCGGCAACGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGCCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGACTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATCTACTACTGGTTCCGCCACGAGCAGAGCCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCACCAGAGCCCGCCGAACTACGCCAGCGTGCCCTACTACCCGCCGACCCTGGAACAGCGCGAGCGC
GACCATTTCTACGACTGGCACATGGCGCGCGAGGTGCAGTCCGGCTCACTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGCTCGCACGCGGCGGCCGACTACCC
GCTGTACGACTACCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGGACCCGCATCGAA
GCCTTGCAGGCGCGCTACGAACGGGTGCGCCTGCGCGGCCGCGCCCGCGGCCTGGGTTCGGGCCACCTGT
TCAAGCTCAGCGGCTACCCGCGCGAGGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAGTACCGGGT
GGTCCAGGAACTCTACGAGACCGGCGGCGGCGGGGTCGGCGCGCAGTTCGAGAGCGAGCTGGACTGCATC
GATGCCGGCCAGGCCTACCGCCCCTTGCCGACCACTCCGCTGCCGATCGTCCGTGGCCCGCAGACTGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGATCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGTTCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
TACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACCGTGCACGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATAACCATCGGCGTCGACCGCACCGAGAAGGTCGGC
AACAACGAGAAGATCAGTATCGGCGCGAACCGCACCGAGGACGTCGGCAGCAACGAGACCATCAGCATCG
GCGTCGACCGCACCGAGAAGGTCGGCAGCAACGAGAAGATCAGCATCGGTGCCAATCGCACCGAGGACGT
CGGCAACGACGAGACCATCAGCATCGGCGCGAACCGTAGCGAGTCGGTGGGCAACAACGAGACGATCAGC
ATCGGCGCCGACCGCAGCGAGTCGGTGGGCGCCAACGAGACCATCGACATAGGCGGCAACCAGAGCACCA
GCATCGGCAAGAACGAGTCGCGCAGCGTCGGCCAGGGCCGCGATACCTCGGTGGGCAAGGACGATAGCCT
GGACGTGGGCAAGAGCTTCACGCTCAACGCCGGCGACTCGATCACCCTGGTCACCGGTGCCGCCAGCATC
CGCATGAAGAAGGACGGCAGCATCGTCATCAGCGGCAAGAACATCACCATCGACGGATCCGGGGCGATCA
ACGTCAAGGCCGACAAGAACGTGGTGGTGAAGGGACGCAAGATCCTCCAGAACTGA