SecReT6
Protein ID: 514409105
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08815
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1862659..1864215 [+]
Producttype VI secretion protein ImpA
NoteTssA
UniProt IDR9ZCL5
KEGG IDprp:M062_08815
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-22, Aligned region: 55..115
Protein Sequence: 518 a.a.     [Download]
>gi|514409105|ref|YP_008132207.1| type VI secretion protein ImpA [Pseudomonas aeruginosa RP73]
MTYSSKLSSHYLELAEQPISKDVFAGEDVSFSSEYEALENELGKALSLHENGQTDWLKILENSEALLRAQ
SKDLRVAAWLTWALYQRESFPGLLAGLGLLERLCSRHWVEIHPLKARTRAAAIAWLVPRLEQALNENVPI
KEQLPLFRRLAEHLEKLDTALTAQLGDDAPLLLPISRRLSGMLQRAADNQPEPGVVGAVVAQVKQAASQL
LAPGAPIDNERDAHKAMRAQQEAARPLCAWWLKQKATDLRALRLNRTILWLPIESMPERNAEQVTALRGV
PADKLKSYQERFAQGLYADLLVELEASLARAPFWFDGQRLVWECLQGLNAEQAMREVEMHFALLLQRLPG
LVELRFHDGSAFADAATRGWISAHVMPHLQNDSAPRKVETVALQAEWDVALDEVQPVLRKDGLKAAVQVL
KQGMKRAHGGRARFFWQLSLARLCFLAKKYELAKTQLESLDHQLHESGLHAWEPDLALDVLHLLHSCCEL
LPQNHAVRERKEDIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1862659-1864215 Pseudomonas aeruginosa RP73, complete genome
ATGACCTATTCGAGCAAGCTCTCCTCGCATTATCTGGAACTCGCGGAACAGCCGATTTCAAAGGATGTCT
TTGCGGGTGAGGATGTGAGTTTTTCCAGCGAATACGAGGCGCTGGAAAATGAGCTGGGCAAGGCGCTCTC
GCTCCATGAGAACGGCCAGACCGACTGGTTGAAAATCCTGGAAAACAGCGAAGCGCTGCTTCGTGCCCAA
TCCAAGGACCTGCGTGTTGCAGCCTGGTTGACCTGGGCCCTCTACCAACGGGAATCCTTTCCCGGTTTGC
TGGCCGGACTGGGATTGCTGGAACGTCTGTGCAGCCGGCATTGGGTCGAGATCCATCCGCTCAAGGCGCG
CACTCGCGCCGCGGCCATTGCCTGGCTGGTGCCCCGGCTGGAGCAGGCGCTGAACGAGAACGTACCGATC
AAGGAGCAACTCCCCCTGTTCCGGCGTCTCGCCGAGCACCTGGAAAAACTCGATACCGCGCTGACCGCGC
AACTGGGCGACGACGCGCCCTTGTTGCTGCCGATCAGCCGACGCCTTTCGGGCATGCTCCAGCGCGCCGC
CGACAACCAGCCCGAACCTGGCGTGGTCGGCGCCGTGGTGGCCCAGGTCAAGCAGGCGGCCAGCCAGTTG
CTGGCGCCGGGTGCGCCCATCGACAACGAGCGCGACGCCCACAAGGCCATGCGCGCCCAGCAGGAGGCCG
CACGCCCCCTGTGCGCCTGGTGGCTGAAGCAGAAAGCCACCGATCTGCGCGCGCTGCGCCTCAACCGAAC
GATACTCTGGCTGCCCATCGAGTCCATGCCCGAGCGCAATGCCGAACAGGTCACCGCGCTAAGGGGAGTG
CCGGCGGACAAGCTGAAAAGCTACCAGGAGCGTTTCGCCCAGGGCCTGTACGCCGATCTCCTGGTGGAGC
TGGAGGCGAGCCTGGCACGGGCGCCGTTCTGGTTCGACGGCCAGCGCCTGGTCTGGGAGTGCCTGCAAGG
GCTCAACGCCGAGCAGGCGATGCGGGAAGTCGAAATGCATTTCGCCTTGCTCCTGCAGCGTCTGCCGGGG
CTGGTGGAGCTGCGTTTCCACGATGGCAGCGCATTCGCCGATGCGGCCACCCGCGGCTGGATCAGCGCCC
ATGTCATGCCCCATCTCCAGAACGACAGTGCGCCGCGCAAGGTCGAGACCGTGGCCCTGCAGGCCGAATG
GGACGTCGCCCTGGACGAGGTCCAGCCGGTGTTGCGCAAGGACGGCCTGAAGGCGGCGGTACAGGTGTTG
AAGCAGGGCATGAAGCGCGCCCACGGCGGACGCGCCCGGTTCTTCTGGCAACTGAGCCTCGCGCGACTGT
GCTTCCTGGCGAAGAAGTACGAGCTGGCCAAGACCCAGCTGGAGAGCCTCGACCATCAGTTGCACGAATC
GGGATTGCACGCCTGGGAGCCCGATCTGGCGCTGGATGTACTGCACCTGCTGCATAGCTGCTGCGAGCTG
TTGCCGCAGAACCACGCCGTGCGAGAACGCAAGGAAGACATTTATCGCAGGCTGTGCCACCTCGATCTCG
AGGTGGTGCTCGAATAG