SecReT6
Protein ID: 514409106
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08820
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1864251..1864757 [+]
Producthypothetical protein
NoteTssB
UniProt IDR9ZDK5
KEGG IDprp:M062_08820
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.70E-54, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|514409106|ref|YP_008132208.1| hypothetical protein M062_08820 [Pseudomonas aeruginosa RP73]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRTDERKVEDRKPIGIDKMTFDEVLAKQE
LGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDESRSRVLGELGLSAAPSQDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1864251-1864757 Pseudomonas aeruginosa RP73, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCAAAGGAACGCATCAACGTCACCTTCAAGCCCGCCACTGGCGGTG
CCCAGGAAGAAATCGAACTGCCGTTGAAGCTACTGGCGATCGGCGATTACACCCAGCGCACGGATGAGCG
CAAGGTGGAGGACCGCAAGCCGATCGGCATCGACAAGATGACCTTCGACGAGGTCCTGGCCAAGCAGGAG
CTGGGGCTGACGCTGAGCGTACCCAATCGTCTCCAGGAGGAGGGCGGCAGCGACGAGCTGGCGGTGGGGC
TGCAGATCAACTCGATGAAGGACTTCAACCCGGCCAGCATCGTCGAGCAGGTGCCCGAGCTGAAGAAGCT
GATGGAGTTGCGCGATGCGTTGGTGGCCCTCAAGGGCCCGCTGGGCAACGCCCCGGCGTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGACGACGAGTCCCGTAGCCGTGTGCTGGGCGAGCTGGGGCTGAGCGCCGCCC
CCTCCCAGGACGCCTGA