SecReT6
Protein ID: 514409107
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08825
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1864786..1866261 [+]
Producttype VI secretion protein
NoteTssC
UniProt IDR9ZBG6
KEGG IDprp:M062_08825
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-192, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|514409107|ref|YP_008132209.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MSTSAAQQGRNQNGEYNILDSIIAETRLSPDDEAYDIAKRGVSAFIEELLKPQNDGEPVKKAMVDRMIAE
IDAKLSTQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSKQDLLDDFEDSPEVMQSGLYK
HIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRQSEDSRYVALTVPRFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAF
GTKLTDSFAKYRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRK
GSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1864786-1866261 Pseudomonas aeruginosa RP73, complete genome
ATGAGCACCAGTGCCGCACAGCAAGGCCGGAACCAGAACGGCGAATACAACATTCTCGACAGCATCATCG
CCGAGACCCGCCTGAGCCCGGACGACGAGGCCTACGACATCGCCAAGCGCGGCGTCTCCGCCTTCATCGA
GGAATTGCTCAAGCCGCAGAACGACGGCGAGCCGGTGAAGAAGGCGATGGTCGACCGGATGATCGCCGAG
ATCGACGCCAAGCTCAGCACGCAGATGGACGAGATTCTCCATCATCCCGATTTCCAGGCGCTGGAGTCGG
CCTGGCGCGGCCTGCAACTGCTGGTCGACCGCACCAACTTCCGCGAGAACATCAAGATCGAGATTCTCAG
CGTTTCCAAGCAGGACCTGCTGGACGATTTCGAGGACTCGCCCGAGGTGATGCAGTCCGGCCTGTACAAG
CACATCTACACCGCCGAATACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCCATCATCGCCAACTACTACA
TGTCGCCCAGTTCGCCCGACGTCAAGCTGATGCAATACGTCTCCAGCGTGGCCTGCATGGCCCATGCGCC
ATTCGTGGCGGCCGCCGGTCCGAAGTTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTGAAGGAC
CTGAAGGATCATTTCGAAGGCCCGCAGTTCGCCAAGTGGCAGAGCTTCCGCCAGTCCGAGGATTCCCGCT
ACGTGGCGCTGACCGTACCGCGCTTCCTGCTGCGCACGCCCTACGATCCGGAAGAGAATCCGGTCAAGTC
GTTCGCCTACAAGGAGACCGTGGCCAACAGCCACGAGCATTACCTGTGGGGCAACACCGCCTATGCCTTC
GGCACCAAGCTGACCGACAGCTTCGCCAAGTATCGCTGGTGCCCGAACATCATCGGGCCGCAGAGCGGCG
GTGCGGTAGAGGACCTGCCGTTGCACCACTTCGAGAGCATGGGCGAGATCGAGACCAAGATCCCCACCGA
GGTGCTGGTGTCCGATCGCCGCGAGTACGAACTGGCCGAGGAAGGCTTCATTTCCCTGACCATGCGCAAG
GGCAGCGACAACGCCGCGTTCTTCTCCGCCAGCTCGGTGCAGAAGCCGAAGTTCTTCGGCATCAGCGCCG
AAGGCAAGGCCGCGGAGCTGAACTACAAGCTCGGCACCCAGTTGCCGTACATGATGATCGTCAACCGCCT
GGCCCATTACCTGAAGGTCCTGCAACGCGAACAGCTGGGGTCGTGGAAGGAGCGTACCGACCTCGAGCTG
GAGCTGAACAAGTGGATCCGCCAGTACGTCGCCGACCAGGAAAACCCCAGCGCCGAAGTGCGCGGCCGTC
GCCCGCTGCGCGCTGCACAGATCATCGTCAGTGACGTCGAGGGCGAGCCGGGCTGGTACCGCGTCAGCCT
GAACGTGCGCCCGCACTTCAAGTACATGGGGGCGGACTTCACCCTGTCGCTGGTCGGCAAGCTGGACAAA
GAGTAA