SecReT6
Protein ID: 514409108
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08830
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1866274..1866681 [+]
Producthypothetical protein
NoteTssE
UniProt IDR9ZDX4
KEGG IDprp:M062_08830
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-18, Aligned region: 24..114
Protein Sequence: 135 a.a.     [Download]
>gi|514409108|ref|YP_008132210.1| hypothetical protein M062_08830 [Pseudomonas aeruginosa RP73]
MTGYGSLFERLNGDADKRVGWSREVSAMASVAAHLGKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARSAIEGFIEAYEPRLSDVRVVSLPRDNDQLRLAFSIEGLLEVEGFKRQVSFSACLDGSGQVKVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1866274-1866681 Pseudomonas aeruginosa RP73, complete genome
ATGACCGGATACGGCAGCCTGTTCGAGCGCCTGAACGGCGACGCGGATAAGCGCGTCGGCTGGAGCCGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGGCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACTCCCTGAGCCAG
GCCCGCTCGGCCATCGAAGGTTTCATCGAGGCTTACGAACCGCGCTTGAGCGACGTGCGTGTCGTTTCCC
TGCCACGCGACAACGACCAGCTCCGCCTGGCCTTCAGCATCGAAGGGTTGCTGGAGGTGGAAGGTTTCAA
GCGCCAGGTGAGTTTTTCCGCATGCCTGGATGGCAGCGGCCAGGTGAAGGTCAGCTAA