SecReT6
Protein ID: 514409111
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08845
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1869778..1872411 [+]
ProductATPase AAA
NoteTssH
UniProt IDR9ZDK9
KEGG IDprp:M062_08845
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.50E-44, Aligned region: 208..286
AAA_2 [PF07724], Evalue: 7.50E-44, Aligned region: 611..776
AAA [PF00004], Evalue: 4.80E-20, Aligned region: 210..341
AAA [PF00004], Evalue: 4.80E-20, Aligned region: 616..739
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 210..232
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 615..734
ClpB_D2-small [PF10431], Evalue: 6.80E-12, Aligned region: 441..457
ClpB_D2-small [PF10431], Evalue: 6.80E-12, Aligned region: 735..765
ClpB_D2-small [PF10431], Evalue: 6.80E-12, Aligned region: 787..856
AAA_22 [PF13401], Evalue: 6.40E-09, Aligned region: 156..175
AAA_22 [PF13401], Evalue: 6.40E-09, Aligned region: 209..296
AAA_22 [PF13401], Evalue: 6.40E-09, Aligned region: 614..720
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 11..97
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 188..232
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 254..288
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 586..651
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 680..709
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 763..842
AAA_17 [PF13207], Evalue: 5.70E-07, Aligned region: 210..278
AAA_17 [PF13207], Evalue: 5.70E-07, Aligned region: 457..457
AAA_17 [PF13207], Evalue: 5.70E-07, Aligned region: 614..650
Sigma54_activat [PF00158], Evalue: 9.70E-06, Aligned region: 150..180
Sigma54_activat [PF00158], Evalue: 9.70E-06, Aligned region: 205..227
Sigma54_activat [PF00158], Evalue: 9.70E-06, Aligned region: 615..734
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 210..237
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 615..654
Clp_N [PF02861], Evalue: 2.70E-05, Aligned region: 30..75
Clp_N [PF02861], Evalue: 2.70E-05, Aligned region: 104..124
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 210..234
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 266..305
AAA_25 [PF13481], Evalue: 8.90E-05, Aligned region: 612..644
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 204..229
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 615..633
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 210..347
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 614..697
AAA_18 [PF13238], Evalue: 0.00027, Aligned region: 210..233
AAA_18 [PF13238], Evalue: 0.00027, Aligned region: 616..652
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 203..227
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 613..640
AAA_19 [PF13245], Evalue: 0.00072, Aligned region: 207..235
AAA_19 [PF13245], Evalue: 0.00072, Aligned region: 355..386
AAA_19 [PF13245], Evalue: 0.00072, Aligned region: 482..511
AAA_19 [PF13245], Evalue: 0.00072, Aligned region: 613..637
DUF258 [PF03193], Evalue: 0.0008, Aligned region: 176..229
DUF258 [PF03193], Evalue: 0.0008, Aligned region: 614..627
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 210..236
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 258..290
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 615..650
AAA_23 [PF13476], Evalue: 0.0025, Aligned region: 210..226
AAA_23 [PF13476], Evalue: 0.0025, Aligned region: 442..492
AAA_23 [PF13476], Evalue: 0.0025, Aligned region: 613..641
Zeta_toxin [PF06414], Evalue: 0.0054, Aligned region: 208..231
Zeta_toxin [PF06414], Evalue: 0.0054, Aligned region: 614..655
RNA_helicase [PF00910], Evalue: 0.0099, Aligned region: 211..231
RNA_helicase [PF00910], Evalue: 0.0099, Aligned region: 616..636
Protein Sequence: 877 a.a.     [Download]
>gi|514409111|ref|YP_008132213.1| ATPase AAA [Pseudomonas aeruginosa RP73]
MSMINVDLQQLIQALDADTRRDLEGSAERCVARGGSKVLVEDLLLGLLERPQGLLARALQDAAVDAGELN
AALQARGEHSASRNPVFAPELVQWLQDALLLANLELGRSQIDQAALILALLRNPLRYAGSRYQPLLARLD
IERLKDFALSQPLEGALSGKPGGGESLLQRFTHNLTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPI
VVGEAGVGKTAIVEGLASRIAAGEVPPALRDVELLSLDMGLLQAGASVKGEFERRLKGVIDEVKAALRPT
ILFIDEAHTLIGAGGQAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPSV
AEAVTILRGLARVYEESHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLE
RLRGELAEGERQRQALRRDAEAGLPIDHDALQALEERLAQAESERHVQEDQWSRQRELAERLLALRQQLA
RAREANREEQGGEADAETFPADEHGGVEALEKALHETRQALADAQAQGRLVSFEVCPRLVAEVIGAWTGV
PVEQLAREHNAKVMGFADDLRARIRGQEQAVSALDRAMRATAAGLNKPDAPVGVFLLVGPSGVGKTETAL
ALADLLYGGERFITTINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDV
LNLFYQIFDKGVANDGEGREIDFRNTLILMTSNLASEHIAALCQDGARPSAELLEETIRPALSRHFKPAL
LARMRVVPYYPVGGPVLRELIEIKLQRLGERLARRQLAFDYSQALVGHLAERCTQSDSGARLIDHLLDTH
LLPLVADRLLEAMARDERLERVHATLGEHGRVLCEFA
 
Nucleotide Sequence: 2634 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1869778-1872411 Pseudomonas aeruginosa RP73, complete genome
ATGAGCATGATCAACGTAGACCTGCAACAACTGATTCAGGCGCTGGATGCCGACACCCGGCGCGACCTCG
AAGGCTCGGCCGAGCGCTGCGTAGCCCGTGGCGGCAGCAAGGTACTGGTGGAGGACCTGTTGCTGGGCCT
GCTGGAGCGTCCCCAGGGACTGCTGGCGCGCGCCCTGCAGGATGCCGCGGTGGACGCCGGCGAACTCAAC
GCCGCGTTGCAAGCGCGGGGCGAGCATAGTGCCTCGCGCAATCCGGTGTTCGCGCCCGAGCTGGTGCAGT
GGCTGCAGGATGCGCTGTTGCTGGCCAACCTCGAACTGGGCCGTAGCCAGATCGACCAGGCGGCATTGAT
CCTGGCCCTGCTACGCAACCCGTTGCGCTATGCCGGCAGCCGCTACCAGCCGCTGCTGGCGCGGCTCGAC
ATCGAGCGGTTGAAGGATTTCGCGCTCTCGCAGCCGCTGGAGGGCGCGCTCAGCGGCAAGCCGGGCGGCG
GCGAGTCCCTGTTGCAGCGTTTCACCCACAACCTTACCCAGCAGGCGCGCGACGGCAAGCTCGATCCGGT
GCTCTGTCGCGACGGGGCTATTCGCCAGATGGTCGACATCCTGGCCCGTCGGCGGAAAAACAACCCCATC
GTGGTCGGCGAGGCCGGCGTCGGCAAGACCGCCATCGTCGAAGGCCTGGCCTCGCGGATCGCCGCAGGGG
AAGTGCCGCCGGCGCTGAGGGACGTCGAGCTGTTGTCCCTCGACATGGGCCTGTTGCAGGCCGGTGCCAG
CGTGAAGGGCGAGTTCGAGCGGCGCCTGAAAGGCGTCATCGACGAAGTGAAGGCAGCGCTCAGGCCGACC
ATCCTGTTCATCGACGAGGCCCATACGCTGATCGGCGCGGGCGGTCAGGCCGGCGGCTCGGATGCCGCCA
ACCTGCTAAAGCCGGCCCTGGCACGTGGCGAGTTGCGCACCATCGCGGCGACGACCTGGGCCGAATACAA
GAAGTATTTCGAGAAGGACCCGGCGCTGGCCCGGCGCTTCCAGCCCGTGCAGTTGCATGAGCCGAGCGTT
GCCGAGGCGGTGACGATCCTGCGTGGCCTGGCCCGGGTTTACGAGGAAAGCCACGGTATCTACCTGCGCG
ACGACGCGGTGGTGGCCGCCGCCGAACTGTCCGCCCGCTACCTGGCGGGTCGCCAGTTGCCGGACAAGGC
CGTCGACGTCCTCGACACCGCCTGTGCGCGGGTGCGCATCAGCCTGGCGGCGGCGCCGGAGAGCCTCGAG
CGCCTGCGCGGCGAGCTGGCCGAAGGCGAGCGCCAGCGCCAGGCCCTGCGCCGCGATGCCGAGGCAGGCC
TGCCGATCGACCACGATGCCCTGCAGGCGCTGGAGGAGCGCCTGGCCCAGGCGGAAAGCGAGCGGCACGT
ACAGGAGGACCAGTGGAGCCGCCAGCGCGAACTCGCCGAGCGCCTGCTCGCCCTGCGCCAGCAATTGGCC
AGGGCCCGCGAGGCGAACCGGGAAGAGCAGGGCGGCGAGGCGGACGCGGAGACTTTCCCGGCCGACGAGC
ATGGCGGTGTCGAAGCCCTGGAAAAGGCCCTTCACGAAACCCGCCAGGCGCTCGCCGATGCCCAGGCCCA
GGGGCGGCTGGTCAGCTTCGAGGTCTGCCCGCGCCTGGTTGCCGAGGTGATCGGCGCCTGGACCGGCGTA
CCGGTGGAACAACTGGCGCGGGAACACAACGCCAAGGTGATGGGGTTCGCTGACGACCTGCGGGCGCGGA
TCCGTGGCCAGGAACAGGCGGTCAGCGCCCTGGACCGCGCGATGCGCGCCACCGCGGCCGGGCTGAACAA
GCCCGATGCGCCGGTCGGCGTGTTCCTGCTGGTGGGCCCGAGCGGGGTGGGCAAGACCGAGACCGCGCTG
GCGCTGGCCGACCTGCTGTATGGCGGCGAGCGTTTCATCACCACCATCAACATGTCCGAGTTCCAGGAGA
AGCACACCGTCTCGCGCCTGATCGGCGCGCCGCCCGGCTATGTCGGCTATGGCGAGGGTGGCATGCTCAC
CGAGGCGGTACGCCAGAAGCCCTATTCGGTGATATTGCTGGACGAGGTGGAGAAGGCCGATCCGGACGTG
CTCAACCTGTTCTACCAGATCTTCGACAAGGGCGTGGCCAACGATGGCGAAGGGCGCGAGATCGATTTCC
GCAATACCTTGATCCTGATGACCTCCAACCTCGCCAGCGAGCACATCGCCGCGCTTTGCCAGGACGGCGC
GCGGCCTTCCGCCGAACTCCTGGAGGAAACCATCCGGCCGGCGCTCAGCCGGCATTTCAAGCCGGCGCTG
CTGGCGCGCATGCGCGTGGTGCCTTACTACCCGGTGGGCGGCCCGGTACTGCGCGAGCTGATCGAGATCA
AGCTGCAACGCCTCGGCGAGCGCCTGGCGCGCCGTCAACTGGCTTTCGACTACAGCCAGGCGCTGGTGGG
CCACCTGGCCGAGCGTTGCACCCAGAGCGACAGCGGCGCACGGTTGATCGACCACCTGCTGGACACGCAC
CTGCTGCCGCTGGTGGCCGACCGTTTGCTGGAAGCGATGGCGCGCGACGAGCGTCTCGAGCGGGTCCATG
CGACGCTGGGCGAGCACGGCCGCGTGCTCTGCGAGTTCGCCTGA