SecReT6
Protein ID: 514409115
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08865
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1875370..1875885 [+]
Producttype VI secretion protein
NoteTssJ
UniProt IDR9ZCM5
KEGG IDprp:M062_08865
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.30E-42, Aligned region: 22..157
Protein Sequence: 171 a.a.     [Download]
>gi|514409115|ref|YP_008132217.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MIAMSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHP
VAFENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVGEGSRYVGVLAAYRDLGEASWRYVVPV
TAKELTRVELKLSQKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1875370-1875885 Pseudomonas aeruginosa RP73, complete genome
ATGATCGCCATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGC
TGGCCGGCTGTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGA
GCGGGTCAATCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAACACCCG
GTGGCGTTCGAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGG
TGACCAGCGAGGAGCTGGAGCTGCGTCCCGGCGAGCGGGTCGAACTCAAGCTCAGCGTGGGGGAGGGGAG
CCGCTACGTGGGCGTGCTCGCCGCCTACCGTGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTC
ACGGCGAAAGAGCTGACCCGGGTAGAGCTGAAGCTGAGCCAGAAGGGCATCCTGAATGCCGGCGAACTGC
TCGGCAAGGCGGGTGACGCGCGATGA