SecReT6
Protein ID: 514409116
SecReT6 ID813
T6SS typei1
Gene symbol-
Locus tagM062_08870
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1875882..1877213 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDR9ZDL5
KEGG IDprp:M062_08870
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.60E-144, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|514409116|ref|YP_008132218.1| type VI secretion protein [Pseudomonas aeruginosa RP73]
MNVHKIVWQEGMLLRPQHLQHNDRYYDNQMKARTQLLGSYNWGFLALELDRQFLNMGKLVISQASGVLPD
GSLFELGGNTEPLALDVPPNTSNVPIYLALPLVTGNHIEARRPEQAEVLARYTAYDLEVADSNAGEDSMV
QVSCARPDFRLLLGEQQSDQAYVKLKVAVVLDTTPDGVISLDPDFVPSYLHAHASAYLLSCLKEVISMLG
HRGDTIAERIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLGLEQVHPEQLYRVLLTMLGDLATFGSESK
RPRLDSRYQHSDQGASFRRLMEAIRQVLSMVLEQHAIELPLQARQYGILVSPLHDHKLLGSASFVLAASA
NCESEELRQRLPAHLKVGAVEHIRQLVNLHLPGIRVKPLPVAPRQIPFHSNKTYFILEPNAEDMAQLERS
GGFAFHVSGEFSELELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|514407635|ref|NC_021577.1|:1875882-1877213 Pseudomonas aeruginosa RP73, complete genome
ATGAACGTGCACAAGATCGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCACCTGCAACACAACGACC
GCTACTACGACAACCAGATGAAGGCCCGGACCCAGTTGCTGGGCAGCTACAACTGGGGCTTCCTCGCCCT
GGAGCTGGACCGCCAGTTCCTCAACATGGGCAAGCTGGTGATCAGCCAGGCCTCCGGCGTATTGCCCGAC
GGCAGCCTGTTCGAACTCGGCGGCAATACCGAGCCGCTCGCCCTCGACGTGCCGCCCAATACCTCGAACG
TGCCGATCTACCTGGCCCTGCCGCTGGTCACCGGAAACCACATCGAGGCGCGTCGGCCGGAGCAGGCCGA
GGTCCTGGCGCGCTATACCGCCTACGACCTGGAGGTGGCGGACTCCAACGCCGGCGAGGATTCCATGGTG
CAGGTCAGCTGCGCGCGGCCGGATTTTCGCCTGCTGCTCGGCGAGCAGCAGAGCGACCAGGCCTACGTCA
AACTGAAGGTGGCGGTGGTGCTGGATACCACGCCGGACGGGGTGATCAGCCTCGACCCCGACTTCGTGCC
GAGCTACCTCCACGCCCACGCATCCGCCTACCTGCTGTCCTGCCTGAAGGAAGTGATCAGCATGCTCGGC
CATCGCGGCGACACCATCGCCGAGCGTATCCGGTCCAATGGCAAGGTCGGCGGCGCGGAGGTCGGCGATT
TCATGATGCTGCAACTGATCAATCGCACCGAGTTGCTGCTGCGCCACTACCTGGGATTGGAGCAGGTGCA
TCCGGAGCAGTTGTACCGGGTGCTGCTGACCATGCTCGGCGACCTCGCCACCTTCGGCAGCGAGAGCAAG
CGTCCGCGCCTGGACAGCCGTTACCAGCACAGCGACCAGGGCGCCAGCTTCCGCAGGCTGATGGAGGCGA
TCCGTCAGGTCCTGTCGATGGTGCTCGAGCAGCATGCCATCGAACTGCCTCTCCAGGCCCGCCAGTACGG
CATCCTGGTCTCGCCCCTGCACGACCACAAGCTGCTCGGCAGCGCCTCGTTCGTGCTCGCCGCCAGTGCC
AATTGCGAGTCGGAGGAACTGCGCCAGCGGCTGCCCGCGCATCTCAAGGTGGGTGCGGTCGAGCACATTC
GCCAACTGGTCAACCTGCACCTGCCGGGGATCCGGGTCAAGCCGCTGCCGGTGGCGCCGCGGCAGATCCC
GTTCCACTCCAACAAGACCTATTTCATTCTCGAACCCAACGCCGAGGACATGGCCCAGCTGGAGCGCTCC
GGCGGTTTCGCGTTCCACGTATCCGGCGAGTTCTCCGAGCTTGAACTGAAATTCTGGGCCATCAGGAACT
GA