SecReT6
Protein ID: 514412674
SecReT6 ID812
T6SS typei3
Gene symbol-
Locus tagM062_00420
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]99267..100790 [-]
Productsignal peptide protein
NoteFha
UniProt IDR9ZQL8
KEGG IDprp:M062_00420
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-15, Aligned region: 29..97
Protein Sequence: 507 a.a.     [Download]
>gi|514412674|ref|YP_008130550.1| signal peptide protein [Pseudomonas aeruginosa RP73]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVAQPLPTAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPQPQPQPQPQPASVAAPTPPASATATAGGDLLQAFLRGAGMTQLKVDPAGAEAQMEAIGRSYRGLV
EGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVANSFEDLKAH
QLAVMAGVQAAIRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFG
REFSRAYEEHSARLRRS
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c100790-99267 Pseudomonas aeruginosa RP73, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCATGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCCCTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCCGCCCCCCGCGACCACTCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGCCCAGCCGCTGCCGACGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCAGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCAGCCAGCGTGGCGGCGCCGACGCCAC
CGGCAAGCGCCACCGCGACGGCCGGCGGCGACCTGCTGCAGGCGTTCCTGCGCGGCGCCGGCATGACCCA
GTTGAAGGTCGACCCGGCCGGCGCCGAAGCGCAGATGGAAGCCATCGGACGCAGCTATCGCGGCCTGGTG
GAAGGACTGGTGGACGTGCTGCGCGCGCGGGCCAGCCTGAAGGGCGAGTTCCGCATGGCGCAGACCATGA
TCCAGCCGGTGCAGAACAACCCGCTGAAGTTCGCGCCGAACGTCGACGAAGCCATGCTGCTCCTGCTGCG
CCGCGACAACCAGGCGTTCATGGCGCCGGATCGCGCGGTGGCCAACAGCTTCGAAGACCTCAAGGCGCAC
CAGCTGGCGGTGATGGCCGGCGTGCAGGCCGCCATCCGCCACCTGCTGGCGCGCTTCGAACCGGCCGCAC
TGGAAGCCCGCTTCGGCAAGCCGGCCGGGCTTTCCGGCCTGCTGCCGGGGGCCCGCCAGGCACAGAACTG
GGACAGTTTCACCGAGCTGTACGCGAAGATCCTGCGCGAGGCGGAGGACGACTTCCAGGAGCTTTTCGGC
CGCGAATTCAGCCGCGCCTATGAGGAACACAGCGCTCGACTACGGCGTTCCTGA