SecReT6
Protein ID: 51594991
SecReT6 ID62
T6SS typei3
Gene symbol-
Locus tagYPTB0640
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]759200..760213 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ66EQ2
KEGG IDyps:YPTB0640
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 183..203
Protein Sequence: 337 a.a.     [Download]
>gi|51594991|ref|YP_069182.1| hypothetical protein YPTB0640 [Yersinia pseudotuberculosis IP 32953]
MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCF
DLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKT
ARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQ
STESYQLHCEQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLD
RILEYFQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|51594359|ref|NC_006155.1|:759200-760213 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
TTGATTTTAAAACGGATGGACAATAATATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATG
ATCCGGCCTATGGCGAGATTGAGTCCATCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCC
GCATGAACCCCCTCAAATAAACTGGCACCATATCAGTGAGCAAGCCAATAAGCTGCTAGAACAATGTTTT
GATTTACGTGTAATGCTTTGGTTTATAAGGGCAAATATTCATATAAAAGGAATCTCGGCCCTCTATGATG
GCTTTATGCGCATTAATGCACAAACCCAAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCC
ATTAAATAGTGGGCATGCCGCCGCATTAGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACT
GCACGCCTTACAGAAGAGCACCCTTACATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGCC
AAGAGAGATATTTTGTTACATCTTCGACATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATT
GCCAGATTTAAAAGACCAATTGACAAAAGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAA
TCCACAGAGAGTTACCAACTGCATTGTGAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTG
CACAATTGAATGCCCCAGAACATGACGATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCT
TGATACTCAGTCCTTTAATTCAAATGATAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGAC
CGTATTCTAGAGTACTTTCAACATTATGAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAG
AGATGATAGGTATGGATTTTTATTCCATTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACA
GTTTACCGGAAAAACTAACCTACCGTTTCGATGA