SecReT6
Protein ID: 51594992
SecReT6 ID62
T6SS typei3
Gene symbol-
Locus tagYPTB0641
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]760224..760784 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ66EQ1
KEGG IDyps:YPTB0641
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-57, Aligned region: 11..165
Protein Sequence: 186 a.a.     [Download]
>gi|51594992|ref|YP_069183.1| hypothetical protein YPTB0641 [Yersinia pseudotuberculosis IP 32953]
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDRKFLTFDQDNF
DARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQMEKLLEARTHLAELITYMDGK
TSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVEDDDGEK
 
Nucleotide Sequence: 561 bp     [Download]
>gi|51594359|ref|NC_006155.1|:760224-760784 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGGCCAAAGATGCGAGCTCGCAAAAATTTATCGGTAGAAATAATGCACCTAGAGTGCAAATTGAATATG
ACGTCGAAATTTATGGTTCAAATAAGAAAGTAGAGTTGCCTTTTGTAACCGGCGTGATGGCTGATCTTTC
TGGCCACAGAGCAAAGCCTCTTCCCGCCGTTGAAGATCGTAAATTCCTTACTTTCGATCAGGATAATTTC
GATGCCCGGATGAGAGCAATTAAGCCTCGCCTTAAATTCTACGTAGATAACACCTTGAGTGAGGATAACG
AACTCCTGGATATCGAACTGGATTTTGAGTCAATGGATGACTTTTCTCCCGGATCGTTAGCGCGGCGTAT
TCCTCAAATGGAAAAACTGCTTGAGGCACGTACCCATCTGGCTGAATTGATCACCTATATGGATGGTAAA
ACCAGCGCAGAAGAGGTGGTTAAACAACTGCTTGAACAACCTGATTTTTTACAAAATCTTGCGACCGATG
CACAGGGAACTATTTCGAAGCTCAGCCAGGATGATGATGTTTTAGTGGAAGATGACGATGGAGAAAAATA
G