SecReT6
Protein ID: 51594994
SecReT6 ID62
T6SS typei3
Gene symbol-
Locus tagYPTB0643
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]762458..762976 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ66EP9
KEGG IDyps:YPTB0643
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-33, Aligned region: 8..148
Protein Sequence: 172 a.a.     [Download]
>gi|51594994|ref|YP_069185.1| hypothetical protein YPTB0643 [Yersinia pseudotuberculosis IP 32953]
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEFRMVSNKASPK
LFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLGKGDAVFTDTVLPTDAISLNF
ARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
 
Nucleotide Sequence: 519 bp     [Download]
>gi|51594359|ref|NC_006155.1|:762458-762976 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGGCAGCTTTAGTCGATTACTTTCTCCATATCGAAGGTGTAGATGGTGAGTCTCCCGATCAGCAGTATA
ACGGATGGATCCAAGTACAGGCTTGGCAATGGGCGGAGGAGAATGCGGGGCGCTGGGGGCTAGGTGGTGG
TGGTGGTTCTGGGAAAGTCGAAATGAAGGACTTCGAATTTCGCATGGTGAGTAACAAAGCATCACCAAAA
CTATTTTTGATGTGTGCCATCGGTGAACACATTCCGCAGGCCAAGTTGGTGTGTCGTAAATCAGGTCAAG
GTCAACAAGACTTCCTGATTGTTACCTTCAGTAACTGTCTGGTGTCCTCCTTTAAAACTGTCGGCAACAT
GCCTCTTGGTAAAGGGGACGCAGTATTCACCGACACTGTGCTGCCAACGGATGCCATCAGCCTTAACTTT
GCACGTATCGAAGTGGAATACAAAGAGCAGCAACCTGATGGCTCGATGGGGGCCGTGATTAAGGCTGGTT
ACGATCTGAAATTGAACAGCCGTATTTAA