SecReT6
Protein ID: 51595006
SecReT6 ID62
T6SS typei3
Gene symbol-
Locus tagYPTB0655
StrainYersinia pseudotuberculosis IP32953
Repliconchromosome [GenBank: NC_006155] [Browse all T6SS(s) in this replicon]
Location [Strand]777702..779312 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ66EN7
KEGG IDyps:YPTB0655
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-43, Aligned region: 143..338
OmpA [PF00691], Evalue: 1.20E-12, Aligned region: 398..501
Protein Sequence: 536 a.a.     [Download]
>gi|51595006|ref|YP_069197.1| hypothetical protein YPTB0655 [Yersinia pseudotuberculosis IP 32953]
MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEDLADQAASGN
NMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAW
DNAYIAAAMPLLLLVENIRSWPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFN
GLQTPDSYNQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLM
DLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNIL
TWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFINKKNIERLGL
ALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAIGRGESDPLAD
NATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|51594359|ref|NC_006155.1|:777702-779312 Yersinia pseudotuberculosis IP 32953 chromosome, complete genome
ATGAACGAATTTGAACGCCAGATCCGTGCAGCCATTTCCGCAGCACGCAATGGCGCAAAACATGCGGAAC
AGTCACTGACTACACCAATGTGGCAAGCCAAAAGCACCGTAGCCTCATTGGGTGGGATTGTCCCTAGAAG
TGGCTCTTCGTCAACGTCACAGGCGGAGAACTATAAGGAAGATCTCGCGGACCAGGCTGCCTCGGGCAAC
AACATGGCGCGCACGAGTGCGCCACCGGTCACTTTGTATCAGCAACAGCCAAATGCGAATGACAGCTATC
CAAACGGGAATAACAACAATCCAAACGGGGATAACAACAATCCAAACGGGAGTAACAACAATATAGCGAG
AGTACAGCGTATGCCGCATGGCATTTCCAGGGGCTTATATGAGCGCCCTGGGATGTTATTGGGTGCCTGG
GATAACGCCTATATTGCTGCGGCTATGCCTTTGCTGCTGCTGGTGGAAAATATTCGTAGCTGGCCGACGC
GTAACGCCGCAGAGGTCAGGCCACCGATTGTGCGGGAATTACAATATTTCCAGCAACATTTGCAGAAAAA
GAACTACCCGCAAGAAGACATTAACCACCTGTCTTACCTGCTATGTACCTATATCGATGGCATTTTTAAC
GGGCTGCAAACCCCAGACTCCTACAACCAAAGTCTGTTAGTGGAGTTTCACCGTGATGCCTGGGGGGGTG
AGGACTGCTTCGAACATCTGCGGGTCTATATGAACTCGCCGAAACAGTACCGGGAAGTTCTGGAATTCTA
TGATCTGATTATGTGCCTTGGTTTTGACGGTAAATACCAGATGATAGAGCATGGTGCGGTTCTGCTGATG
GATTTACGCAGCCGTCTCCACACGCAACTCTACGGCCAGGACGCCACACAATCTTTGGCTATCGCGCAAG
CGGTCAAAGGTTCTCCGCGTCGCCAATATATCAAGGCGCTGAAAATCTTCACCTATGGTTTCGCACTGTG
CCTTTGTGCTTACGGCGTCACGGCGTGGTATCTGCACCAGCAATCCCAACAGATCCGCAGCAACATTCTG
ACGTGGGTACTGCCTGAACCGCGGAAAATCAACATCATGGAGACCTTGCCGAATCCGCTATCCAACATCC
TGAATGAAGGGTGGCTGGAGGTCAGGAAAGATCCGCGTGGATGGCTATTAATCTTCACCTCCGACGGCGC
GTTCCGCACGGGTGAAGCGACCCTCTCGGAAGAGTTTATCAACAAGAAGAATATCGAACGTCTTGGGCTG
GCATTAGCCCCATGGCCGGGAGATATCGAGGTTATTGGTCATACGGATAACAAACCGTTCCGTAGCACTT
CCGGTAACAACAACCTCAAACTTTCCGCGGCCAGAGCATCGGTGGTGGCAGATAAACTGCGGGAATCCAC
TCAAATCAACGAAACCCATCAGCGAGAAATAAGTGCCATCGGACGGGGGGAGAGCGATCCTTTAGCTGAC
AATGCAACGGAAGAAGGGCGCAAGCGTAACCGGCGTGTGGATATCCTATGGAAAATTGGTCAGCGCGATG
CCGATAAGGCCATGAAGCAATTCCTGGAGAACCCAACACCAGAAGTTCAAGGAACGAATACCCAACAATA
G